GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-22 01:02:11, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001160085             681 bp    mRNA    linear   MAM 19-FEB-2022
DEFINITION  Sus scrofa claudin 22 (CLDN22), mRNA.
ACCESSION   NM_001160085
VERSION     NM_001160085.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ875106.1.
            
            ##Evidence-Data-START##
            Transcript is intronless :: FJ875106.1 [ECO:0000345]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..681
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="15"
                     /map="15"
     gene            1..681
                     /gene="CLDN22"
                     /note="claudin 22"
                     /db_xref="GeneID:100294683"
     exon            1..681
                     /gene="CLDN22"
                     /inference="alignment:Splign:2.1.0"
     CDS             12..668
                     /gene="CLDN22"
                     /codon_start=1
                     /product="claudin-22"
                     /protein_id="NP_001153557.1"
                     /db_xref="GeneID:100294683"
                     /translation="
MALVFRAVAQLAGILLSLLGWVLSCLTNYLPQWKNLNLDLNEMENWTMGLWQTCVIQEEVGWQCKDFDSFLALPAELRISRVLMFLSNGLGFLGLLVSGLGLDCLRIGETQQDVKKRLLILGGVLSWTAGIAALVPVSWVAHVTVQEFWDETLSEVVPRWEFGDALFIGWFAGFFLLLGGCLLSWAACGTRAPLASGHYAVVETGHHRVHPEMKTTHL"
     misc_feature    39..527
                     /gene="CLDN22"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
aggaccttctaatggctttggtatttcgagctgtggcacaattagcaggaattttgttatctttgctgggatgggttttatcttgtcttacaaactacctgccgcaatggaagaacctcaacctggacttaaatgagatggaaaactggaccatgggactctggcaaacctgcgtcatccaagaggaagtgggctggcaatgtaaggactttgattcttttctggctttgccggccgagctcaggatctccagggttttaatgttcctgtcaaatgggctgggattcctgggcctgctggtctcggggctcggcctggactgcttgagaattggagagacacagcaggacgtcaagaagcggctgctgatcctgggaggagttctgtcctggacagcaggcatcgcagccctggttcctgtctcttgggttgcccacgtgacagtccaggagttctgggatgagaccctctcagaggttgtgcccaggtgggagtttggggacgccctctttatcggctggtttgctggcttttttctcctgctaggagggtgtctgctgagctgggcagcctgcgggacccgggctcccctagcttctggccactacgcagtggtggaaactgggcatcaccgtgtacacccggagatgaaaaccactcacctgtaactctaagccagaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]