2025-10-22 01:02:11, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001160085 681 bp mRNA linear MAM 19-FEB-2022 DEFINITION Sus scrofa claudin 22 (CLDN22), mRNA. ACCESSION NM_001160085 VERSION NM_001160085.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FJ875106.1. ##Evidence-Data-START## Transcript is intronless :: FJ875106.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..681 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="15" /map="15" gene 1..681 /gene="CLDN22" /note="claudin 22" /db_xref="GeneID:100294683" exon 1..681 /gene="CLDN22" /inference="alignment:Splign:2.1.0" CDS 12..668 /gene="CLDN22" /codon_start=1 /product="claudin-22" /protein_id="NP_001153557.1" /db_xref="GeneID:100294683" /translation="
MALVFRAVAQLAGILLSLLGWVLSCLTNYLPQWKNLNLDLNEMENWTMGLWQTCVIQEEVGWQCKDFDSFLALPAELRISRVLMFLSNGLGFLGLLVSGLGLDCLRIGETQQDVKKRLLILGGVLSWTAGIAALVPVSWVAHVTVQEFWDETLSEVVPRWEFGDALFIGWFAGFFLLLGGCLLSWAACGTRAPLASGHYAVVETGHHRVHPEMKTTHL"
misc_feature 39..527 /gene="CLDN22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
aggaccttctaatggctttggtatttcgagctgtggcacaattagcaggaattttgttatctttgctgggatgggttttatcttgtcttacaaactacctgccgcaatggaagaacctcaacctggacttaaatgagatggaaaactggaccatgggactctggcaaacctgcgtcatccaagaggaagtgggctggcaatgtaaggactttgattcttttctggctttgccggccgagctcaggatctccagggttttaatgttcctgtcaaatgggctgggattcctgggcctgctggtctcggggctcggcctggactgcttgagaattggagagacacagcaggacgtcaagaagcggctgctgatcctgggaggagttctgtcctggacagcaggcatcgcagccctggttcctgtctcttgggttgcccacgtgacagtccaggagttctgggatgagaccctctcagaggttgtgcccaggtgggagtttggggacgccctctttatcggctggtttgctggcttttttctcctgctaggagggtgtctgctgagctgggcagcctgcgggacccgggctcccctagcttctggccactacgcagtggtggaaactgggcatcaccgtgtacacccggagatgaaaaccactcacctgtaactctaagccagaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]