2024-04-27 11:34:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001160083 865 bp mRNA linear MAM 19-FEB-2022 DEFINITION Sus scrofa claudin 17 (CLDN17), mRNA. ACCESSION NM_001160083 VERSION NM_001160083.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FJ875102.1. ##Evidence-Data-START## Transcript is intronless :: FJ875102.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..865 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="13" /map="13" gene 1..865 /gene="CLDN17" /note="claudin 17" /db_xref="GeneID:100294681" /db_xref="VGNC:VGNC:86734" exon 1..865 /gene="CLDN17" /inference="alignment:Splign:2.1.0" misc_feature 41..43 /gene="CLDN17" /note="upstream in-frame stop codon" CDS 119..796 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="NP_001153555.1" /db_xref="GeneID:100294681" /db_xref="VGNC:VGNC:86734" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFIGSNIIVFERIWEGLWMNCVRQAKARLQCKFYSSMLALSPALEAARALMCVAVALSLIALIIGICGMKKIQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVCWTANIIIRDFYNPAVHVGQKRELGAALFLGWASVAVLFIAGGLLCGFCCCNRKKQRDGYPAPRPSMPRTDERRRNMTRQSETPTSYV"
misc_feature 134..664 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" misc_feature 140..202 /gene="CLDN17" /note="propagated from UniProtKB/Swiss-Prot (C3VMW3.1); transmembrane region" misc_feature 362..424 /gene="CLDN17" /note="propagated from UniProtKB/Swiss-Prot (C3VMW3.1); transmembrane region" misc_feature 491..553 /gene="CLDN17" /note="propagated from UniProtKB/Swiss-Prot (C3VMW3.1); transmembrane region" misc_feature 611..673 /gene="CLDN17" /note="propagated from UniProtKB/Swiss-Prot (C3VMW3.1); transmembrane region" misc_feature 698..793 /gene="CLDN17" /note="propagated from UniProtKB/Swiss-Prot (C3VMW3.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" ORIGIN
tatggacagtaacagtggagaaacacatcagagatcgctctagactcacgggggcctccacgttctgcctggtgagcagcttccactgcagattggatccctcttcaaagcaaaagtaatggcgttttatccactgcaaatcgccggcctggttcttggcttcctgggcatggtcgggactctggctaccactcttctgcctcagtggagagtatcagcttttattggcagcaacattattgtctttgaaaggatctgggaagggctctggatgaactgtgtccgacaagccaaggccaggttgcagtgcaagttctacagttctatgctggctctgtcccctgccctggaagcagcccgggccctcatgtgtgtggctgttgctctgtctttgattgctctgattattggcatctgtggcatgaagaagattcagtgcacaggttctaatgagagggccaaagcctaccttctggggacttctggagtcctcttcatcctgacgggcatcttcgttctgattccagtgtgctggacagccaatatcatcatcagggacttctacaacccagccgtccatgtaggtcagaaacgagagctgggagcagcgctattccttggctgggcaagtgttgctgtcctcttcatcgcaggaggtctgctctgtgggttctgctgttgcaacagaaagaagcaaagggacggatatccagccccgaggcctagcatgccacgcacagatgagagacgtcggaacatgacaaggcagagtgagacccccaccagttacgtctgatatctacttttggctcaaactgtagatagtgaacaatgtgtcttaaagagtcgtgtcagaaactgtaag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]