GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:10:23, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001159542            1386 bp    mRNA    linear   PRI 30-AUG-2020
DEFINITION  Homo sapiens POU class 5 homeobox 1B (POU5F1B), mRNA.
ACCESSION   NM_001159542
VERSION     NM_001159542.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1386)
  AUTHORS   Yi J, Zhou LY, Yi YY, Zhu X, Su XY, Zhao Q, Lin J, Qian J and Deng
            ZQ.
  TITLE     Low Expression of Pseudogene POU5F1B Affects Diagnosis and
            Prognosis in Acute Myeloid Leukemia (AML)
  JOURNAL   Med. Sci. Monit. 25, 4952-4959 (2019)
   PUBMED   31271156
  REMARK    GeneRIF: POU5F1B was underexpressed in AML compared with controls
            (P<0.001). The receiver operating characteristic (ROC) curve
            revealed that the POU5F1B transcript level was able to
            differentiate AML patients from healthy individuals (AUC=0.682). In
            non-APL AML patients.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1386)
  AUTHORS   Meng B, Xing Y, Li H, Gao F and Liu YC.
  TITLE     Knockdown of Long Noncoding RNA POU5F1B Promotes Radiosensitivity
            in Esophageal Carcinoma
  JOURNAL   Med. Sci. Monit. 25, 1214-1219 (2019)
   PUBMED   30763293
  REMARK    GeneRIF: Radiotherapy contributed to the decline in the expression
            level of POU5F1B in plasma, which was upregulated in ECA109,
            ECA9706, KYSE410, and KYSE510, but not in HEEPIC. The knockdown of
            POU5F1B increased the radiosensitivity of esophageal cancer cell
            lines.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1386)
  AUTHORS   Yu J, Zhang J, Zhou L, Li H, Deng ZQ and Meng B.
  TITLE     The Octamer-Binding Transcription Factor 4 (OCT4) Pseudogene, POU
            Domain Class 5 Transcription Factor 1B (POU5F1B), is Upregulated in
            Cervical Cancer and Down-Regulation Inhibits Cell Proliferation and
            Migration and Induces Apoptosis in Cervical Cancer Cell Lines
  JOURNAL   Med. Sci. Monit. 25, 1204-1213 (2019)
   PUBMED   30762028
  REMARK    GeneRIF: POU5F1B was upregulated in cervical cancer and
            down-regulation inhibited cell proliferation and migration and
            induced apoptosis in cervical cancer cell lines by modulating OCT4.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1386)
  AUTHORS   Zhao FQ, Misra Y, Li DB, Wadsworth MP, Krag D, Weaver D, Tessitore
            J, Li DW, Zhang G, Tian Q and Buss K.
  TITLE     Differential expression of Oct3/4 in human breast cancer and normal
            tissues
  JOURNAL   Int. J. Oncol. 52 (6), 2069-2078 (2018)
   PUBMED   29620155
  REMARK    GeneRIF: Study shows that irrespective of tumor type or
            clinicopathological status, breast cancer cells expressed high
            levels of Oct3/4 at mRNA and protein levels. Further sequencing
            analysis show that breast tumors and MCF-7 cell line predominantly
            expressed transcripts of POU5F1B, an Oct4-like gene from chromosome
            8 which possess 94% similitude with oct-4.
REFERENCE   5  (bases 1 to 1386)
  AUTHORS   Panagopoulos I, Moller E, Collin A and Mertens F.
  TITLE     The POU5F1P1 pseudogene encodes a putative protein similar to
            POU5F1 isoform 1
  JOURNAL   Oncol. Rep. 20 (5), 1029-1033 (2008)
   PUBMED   18949397
  REMARK    GeneRIF: that a putative POU5F1P1 protein is localized in the
            nucleus, acts as a transcriptional activator and regulates the
            expression in a similar way to the POU5F1 isoform 1
REFERENCE   6  (bases 1 to 1386)
  AUTHORS   Firsova,N.V., Markintantova,Iu.V., Smirnova,Iu.A., Panova,I.G.,
            Sukhikh,G.T., Zinov'eva,R.D. and Mitashov,V.I.
  TITLE     [Identification of the OCT4-pg1 retrogene and NANOG gene expression
            in the human embryonic eye]
  JOURNAL   Izv. Akad. Nauk. Ser. Biol. (2), 134-138 (2008)
   PUBMED   18946985
REFERENCE   7  (bases 1 to 1386)
  AUTHORS   Suo G, Han J, Wang X, Zhang J, Zhao Y, Zhao Y and Dai J.
  TITLE     Oct4 pseudogenes are transcribed in cancers
  JOURNAL   Biochem. Biophys. Res. Commun. 337 (4), 1047-1051 (2005)
   PUBMED   16229821
REFERENCE   8  (bases 1 to 1386)
  AUTHORS   Marques AC, Dupanloup I, Vinckenbosch N, Reymond A and Kaessmann H.
  TITLE     Emergence of young human genes after a burst of retroposition in
            primates
  JOURNAL   PLoS Biol. 3 (11), e357 (2005)
   PUBMED   16201836
REFERENCE   9  (bases 1 to 1386)
  AUTHORS   Pain D, Chirn GW, Strassel C and Kemp DM.
  TITLE     Multiple retropseudogenes from pluripotent cell-specific gene
            expression indicates a potential signature for novel gene
            identification
  JOURNAL   J. Biol. Chem. 280 (8), 6265-6268 (2005)
   PUBMED   15640145
REFERENCE   10 (bases 1 to 1386)
  AUTHORS   Takeda J, Seino S and Bell GI.
  TITLE     Human Oct3 gene family: cDNA sequences, alternative splicing, gene
            organization, chromosomal location, and expression at low levels in
            adult tissues
  JOURNAL   Nucleic Acids Res. 20 (17), 4613-4620 (1992)
   PUBMED   1408763
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DQ486513.1.
            On Jun 2, 2019 this sequence version replaced NM_001159542.1.
            
            Summary: This intronless gene was thought to be a transcribed
            pseudogene of POU class 5 homeobox 1, however, it has been reported
            that this gene can encode a functional protein. The encoded protein
            is nearly the same length as and highly similar to the POU class 5
            homeobox 1 transcription factor, has been shown to be a weak
            transcriptional activator and may play a role in carcinogenesis and
            eye development. [provided by RefSeq, Apr 2009].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: DQ486513.1, HQ122885.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1386              DQ486513.1         214-1599
FEATURES             Location/Qualifiers
     source          1..1386
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q24.21"
     gene            1..1386
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="POU class 5 homeobox 1B"
                     /db_xref="GeneID:5462"
                     /db_xref="HGNC:HGNC:9223"
                     /db_xref="MIM:615739"
     exon            1..1386
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1451417918"
     variation       4
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1422992303"
     variation       6
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1222513621"
     variation       10
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248676055"
     variation       13
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1468858608"
     variation       15..19
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="cccc"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:1181532664"
     variation       17
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1412856515"
     variation       19
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75427380"
     variation       20..21
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1563683743"
     variation       20
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751686418"
     variation       21
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1264174663"
     variation       22
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1244582260"
     variation       26
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:529087148"
     variation       29
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1389682828"
     variation       30
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746230296"
     variation       35
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756376197"
     variation       39
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1352392757"
     CDS             43..1122
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="POU domain, class 5, transcription factor 1
                     pseudogene 1; POU class 5 homeobox 1 pseudogene 1; octamer
                     binding protein 3_like sequence; POU 5 domain protein; POU
                     domain transcription factor Oct-4; POU domain
                     transcription factor OCT4-pg1"
                     /codon_start=1
                     /product="putative POU domain, class 5, transcription
                     factor 1B"
                     /protein_id="NP_001153014.1"
                     /db_xref="CCDS:CCDS55274.1"
                     /db_xref="GeneID:5462"
                     /db_xref="HGNC:HGNC:9223"
                     /db_xref="MIM:615739"
                     /translation="
MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN"
     misc_feature    373..375
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q01860; propagated from
                     UniProtKB/Swiss-Prot (Q06416.2); phosphorylation site"
     misc_feature    454..678
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    order(733..747,751..753,802..804,817..819,856..858,
                     862..867,874..879,883..891,895..900)
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    739..897
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(739..741,748..750,865..867,874..879,886..888)
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    745..747
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:Q01860; propagated from
                     UniProtKB/Swiss-Prot (Q06416.2); phosphorylation site"
     misc_feature    748..750
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q01860; propagated from
                     UniProtKB/Swiss-Prot (Q06416.2); phosphorylation site"
     misc_feature    904..906
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q01860; propagated from
                     UniProtKB/Swiss-Prot (Q06416.2); phosphorylation site"
     misc_feature    907..909
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q01860; propagated from
                     UniProtKB/Swiss-Prot (Q06416.2); phosphorylation site"
     misc_feature    1102..1104
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q01860; propagated from
                     UniProtKB/Swiss-Prot (Q06416.2); phosphorylation site"
     variation       44
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1408895868"
     variation       45
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1288399514"
     variation       47
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:542388560"
     variation       48
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230726910"
     variation       51
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1034775280"
     variation       54
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1392840697"
     variation       55
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:960493929"
     variation       56
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012378262"
     variation       58
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354892305"
     variation       61
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:576539115"
     variation       62
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210806506"
     variation       63
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1292544763"
     variation       64
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1023316018"
     variation       69
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436267969"
     variation       70
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1389727528"
     variation       72
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771875761"
     variation       77
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252579384"
     variation       78
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772828845"
     variation       79
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185632324"
     variation       81
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746560962"
     variation       82
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473122296"
     variation       83
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1253465586"
     variation       84
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:770900474"
     variation       85
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1339676561"
     variation       90
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061391"
     variation       91
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:562626736"
     variation       92
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1308287700"
     variation       96
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1061393"
     variation       97
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764898370"
     variation       98
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1412389944"
     variation       99
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1586474994"
     variation       101
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1586474998"
     variation       102
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397052243"
     variation       104
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333006811"
     variation       106
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775283624"
     variation       107
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1418400893"
     variation       110..115
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:1246229629"
     variation       110
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286288790"
     variation       111
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:531267041"
     variation       112
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:551358165"
     variation       115
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751627167"
     variation       116
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1344322169"
     variation       117
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208809849"
     variation       121
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767638780"
     variation       122
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:796468582"
     variation       123
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750836510"
     variation       124
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240098531"
     variation       125
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448662233"
     variation       128
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:920880052"
     variation       129
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1482919575"
     variation       132
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1168765459"
     variation       133
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391626654"
     variation       136
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1432545130"
     variation       137
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1171460720"
     variation       140
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1061394"
     variation       141
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756666124"
     variation       143
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1335815501"
     variation       144
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1200669147"
     variation       146..161
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="ggctaagcttccaagg"
                     /db_xref="dbSNP:754502000"
     variation       147
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336744198"
     variation       148
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1363396454"
     variation       150
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:780524404"
     variation       153
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754291935"
     variation       157
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758097906"
     variation       160
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1563683877"
     variation       161
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777622917"
     variation       162
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376562387"
     variation       163
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1231395535"
     variation       165
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780780793"
     variation       166..167
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:778622812"
     variation       167
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255451609"
     variation       171
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745755611"
     variation       173
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202056636"
     variation       174
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1282074605"
     variation       177
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769765063"
     variation       178
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983628372"
     variation       179
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249714208"
     variation       183
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775246122"
     variation       184
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76449652"
     variation       188
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768862753"
     variation       189
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:533483816"
     variation       192
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1174754924"
     variation       193
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762108790"
     variation       196
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345486200"
     variation       197
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767445127"
     variation       198
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1321613473"
     variation       202
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750546034"
     variation       203
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385260212"
     variation       204
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761053358"
     variation       205
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369395842"
     variation       213
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754238636"
     variation       214
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1586475154"
     variation       215..219
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:1286594683"
     variation       216
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755456031"
     variation       217
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779438015"
     variation       219
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751127201"
     variation       220
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:566751463"
     variation       222
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:980517037"
     variation       223..227
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="cccc"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:747688158"
     variation       226
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1442003498"
     variation       228
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3211306"
     variation       230
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1267616503"
     variation       231..236
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ccccc"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:771865314"
     variation       231
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1434608218"
     variation       233
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1179024822"
     variation       234
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1449909985"
     variation       236
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1338968285"
     variation       237
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333732118"
     variation       238
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1410645921"
     variation       239
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1179408652"
     variation       240
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1472531340"
     variation       240
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1160586921"
     variation       242
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780539306"
     variation       244
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1586475219"
     variation       246
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745433783"
     variation       247
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1586475220"
     variation       249
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1061395"
     variation       250
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780034679"
     variation       251
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1388795009"
     variation       253..258
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ggggg"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:559727185"
     variation       253
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:535674373"
     variation       254
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761899644"
     variation       255
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:935213491"
     variation       258
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772377045"
     variation       263
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773140691"
     variation       264
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760863803"
     variation       268
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766985841"
     variation       271..273
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:780624994"
     variation       276
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1061396"
     variation       280..296
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gt"
                     /replace="gttggagtggggctagt"
                     /db_xref="dbSNP:776479433"
     variation       281
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760145963"
     variation       287
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765660142"
     variation       288
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753148261"
     variation       289
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756839675"
     variation       290
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1410800746"
     variation       293
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749898240"
     variation       294
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164492046"
     variation       295
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755556323"
     variation       297
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1464416243"
     variation       298
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779553954"
     variation       300
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012061431"
     variation       301
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749175077"
     variation       303
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1023834179"
     variation       305
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1369961915"
     variation       306
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754939505"
     variation       307
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778540580"
     variation       310
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376864344"
     variation       311
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748022749"
     variation       312
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313117874"
     variation       317
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772168979"
     variation       319
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773546462"
     variation       324
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:555645826"
     variation       327
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1342521019"
     variation       334
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569344346"
     variation       338
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1235293339"
     variation       342
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:77810828"
     variation       345
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760092476"
     variation       346
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552351247"
     variation       347
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558179946"
     variation       348
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200266503"
     variation       349
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1166874377"
     variation       351
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763443282"
     variation       352
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430704621"
     variation       353
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764371674"
     variation       354
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:578063220"
     variation       356
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1447144685"
     variation       357
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1303374394"
     variation       360
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755785393"
     variation       361
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1404020407"
     variation       363
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765835039"
     variation       364
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753384380"
     variation       365
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754885540"
     variation       366
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778964462"
     variation       368
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1275848689"
     variation       369
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1311128048"
     variation       370
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747888292"
     variation       373
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1168796001"
     variation       374
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777438148"
     variation       375
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463101721"
     variation       377
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:983681104"
     variation       378
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747198568"
     variation       382
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1450287336"
     variation       383
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771322061"
     variation       386
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776833446"
     variation       387
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746005783"
     variation       388
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770200466"
     variation       389
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223663790"
     variation       390
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775999702"
     variation       391
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190778660"
     variation       393..398
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:763078225"
     variation       393
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:774729169"
     variation       394
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760289677"
     variation       395
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1019176390"
     variation       396
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766068588"
     variation       397
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182632506"
     variation       398
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368393005"
     variation       399
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:764149088"
     variation       399
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1199480583"
     variation       403
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260178066"
     variation       404
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219300151"
     variation       405
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764655739"
     variation       406
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752618852"
     variation       408
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758286343"
     variation       409
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554089073"
     variation       413
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751452457"
     variation       414
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974933085"
     variation       415
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757541776"
     variation       420
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746846728"
     variation       423
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1431986803"
     variation       427
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:781630176"
     variation       428
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573956416"
     variation       441
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769855568"
     variation       447
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1158364159"
     variation       448
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780020292"
     variation       449
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1428618977"
     variation       454
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946765201"
     variation       456
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402235689"
     variation       463
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769082871"
     variation       464
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348926414"
     variation       466
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:979407883"
     variation       471
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294739141"
     variation       481
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1348117042"
     variation       486
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:923914195"
     variation       488
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1227040792"
     variation       491
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774674067"
     variation       493
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762221989"
     variation       495
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1204711828"
     variation       501
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770563864"
     variation       504
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776196455"
     variation       505
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759119790"
     variation       507
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:896389571"
     variation       508
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1344979016"
     variation       511
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1222629206"
     variation       512
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188813106"
     variation       515
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1482123347"
     variation       516
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:767770484"
     variation       518
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1463613729"
     variation       520
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752192997"
     variation       521
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412614305"
     variation       522
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471152032"
     variation       523
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140000439"
     variation       524
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1412846423"
     variation       527
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764186958"
     variation       528
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1165105079"
     variation       531
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751399282"
     variation       532
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757047532"
     variation       533
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1308175755"
     variation       535
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:576131592"
     variation       547
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445046791"
     variation       549
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756322889"
     variation       551
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1554608391"
     variation       552
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356124343"
     variation       553
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229049549"
     variation       558
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294226629"
     variation       559
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780149602"
     variation       561
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749375956"
     variation       562
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1177638668"
     variation       569
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6998061"
     variation       572
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1424432509"
     variation       573
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252685260"
     variation       574
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:564569832"
     variation       576
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1185369024"
     variation       580
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159793023"
     variation       587
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:13273814"
     variation       588
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249369209"
     variation       590..598
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ccatctgcc"
                     /replace="ccatctgcccatctgcc"
                     /db_xref="dbSNP:1473010513"
     variation       590
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1184979080"
     variation       592
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772362682"
     variation       597
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1428762035"
     variation       598
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773585425"
     variation       599
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1398049742"
     variation       600
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769368694"
     variation       601
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1239403638"
     variation       606
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1332788737"
     variation       607
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769385130"
     variation       612
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779799571"
     variation       615
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208175301"
     variation       617
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1453835593"
     variation       623
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1311668573"
     variation       625
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1317677150"
     variation       626
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775054724"
     variation       628
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762441006"
     variation       630
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251922838"
     variation       631..632
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:1230776015"
     variation       632
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763703745"
     variation       634
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198602970"
     variation       637
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774375118"
     variation       639
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761865135"
     variation       643
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185178695"
     variation       644
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767382393"
     variation       645
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1448460817"
     variation       650
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756336940"
     variation       651
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780723367"
     variation       652
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192151034"
     variation       654
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1476760227"
     variation       656
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1171558442"
     variation       660
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753946832"
     variation       671
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377535415"
     variation       672
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754980784"
     variation       673
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1339066339"
     variation       678
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778975553"
     variation       680
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434582193"
     variation       682
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:13274084"
     variation       683
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529522221"
     variation       684
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1231153637"
     variation       690
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778092645"
     variation       691
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1324147832"
     variation       692
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1205518732"
     variation       693
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265955564"
     variation       695
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747394472"
     variation       698
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1248734784"
     variation       703
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208896380"
     variation       705
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769484945"
     variation       706
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769463125"
     variation       709
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748985437"
     variation       710
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768235193"
     variation       711..714
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="agaa"
                     /replace="agaagaa"
                     /db_xref="dbSNP:1563684410"
     variation       711
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1377735050"
     variation       715..716
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1481024862"
     variation       716
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761812173"
     variation       717
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:749116626"
     variation       721
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770937336"
     variation       722
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314513684"
     variation       724
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1289884806"
     variation       726
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6998254"
     variation       727
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385351737"
     variation       731
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1169220192"
     variation       732..734
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:774496784"
     variation       736..741
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ag"
                     /replace="agaaag"
                     /db_xref="dbSNP:1386426058"
     variation       742
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322929262"
     variation       743
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1368515805"
     variation       748
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1346256095"
     variation       751
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760100990"
     variation       753
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753945426"
     variation       754
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:7002225"
     variation       756
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765256433"
     variation       759
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1262318524"
     variation       760
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:538376803"
     variation       761
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:551571407"
     variation       763
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1268912179"
     variation       765
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1490701091"
     variation       768
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202140426"
     variation       769
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1250241666"
     variation       770
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757507123"
     variation       776
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781638445"
     variation       777
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748851874"
     variation       780
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:917866631"
     variation       794
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162905072"
     variation       797
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1366204741"
     variation       798
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:571698634"
     variation       800
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1045307654"
     variation       801
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1306325038"
     variation       804
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1586475893"
     variation       805
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773976279"
     variation       813..816
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gcag"
                     /replace="gcagcag"
                     /db_xref="dbSNP:1381831651"
     variation       816
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1391932722"
     variation       817
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294159973"
     variation       818
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1586475906"
     variation       819
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308823467"
     variation       820
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931117421"
     variation       821
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772129206"
     variation       822
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292057139"
     variation       823
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1361238040"
     variation       828
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202389521"
     variation       833
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:767622124"
     variation       834
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772954529"
     variation       837
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480570039"
     variation       838
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1323604058"
     variation       842
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182961302"
     variation       846
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1371452471"
     variation       847
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1253029965"
     variation       849
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1422443069"
     variation       851
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:554176727"
     variation       855
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1046876106"
     variation       857
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386083126"
     variation       860
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761530890"
     variation       862
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776516653"
     variation       863
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759719679"
     variation       864
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1435456188"
     variation       865
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765504314"
     variation       867
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752774436"
     variation       871
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762957047"
     variation       873
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265378024"
     variation       875
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1376612801"
     variation       876
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1395232389"
     variation       879
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764250580"
     variation       881
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751963914"
     variation       883
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573985615"
     variation       884
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040676740"
     variation       885
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:533435736"
     variation       886
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1273224093"
     variation       892
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1339566701"
     variation       894
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1307583642"
     variation       897
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1250286478"
     variation       898
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:902103024"
     variation       906
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1205756513"
     variation       909
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:28409416"
     variation       910
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750867584"
     variation       911
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754663669"
     variation       912
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203411233"
     variation       914
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1299073466"
     variation       915
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1244177211"
     variation       917
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446624427"
     variation       919
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778774788"
     variation       922
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747805182"
     variation       923
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1429200633"
     variation       924
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771424910"
     variation       925
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1256369041"
     variation       932
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1425042404"
     variation       936
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357344725"
     variation       937
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1465524852"
     variation       938
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777361565"
     variation       939
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746879083"
     variation       940
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1432368424"
     variation       943
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1296424149"
     variation       949
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770937166"
     variation       951..953
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1029593135"
     variation       952
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310803517"
     variation       954
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776264328"
     variation       957..958
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1491118222"
     variation       958..962
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:533552619"
     variation       959
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759396734"
     variation       960
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1462943947"
     variation       961
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:536151237"
     variation       962
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:868868358"
     variation       966
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1376493673"
     variation       978
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775635108"
     variation       979
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486349137"
     variation       980
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556361752"
     variation       981
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374138216"
     variation       982..1002
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gccccagggccccattttggt"
                     /replace="gccccagggccccattttggtgccccagggccccattttggt"
                     /db_xref="dbSNP:1358368855"
     variation       982
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480042132"
     variation       983
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177086920"
     variation       984
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1249339530"
     variation       985
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751703386"
     variation       988
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762206111"
     variation       989
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768127363"
     variation       990
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1200581082"
     variation       991
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345399204"
     variation       992
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1432514011"
     variation       993
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750810557"
     variation       994
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1366313943"
     variation       995
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1223368331"
     variation       999
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1284482976"
     variation       1000
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756479586"
     variation       1001
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780579414"
     variation       1004
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371019833"
     variation       1005
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1317710053"
     variation       1007
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758096671"
     variation       1012
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1290019306"
     variation       1013
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:956784524"
     variation       1016
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1563684651"
     variation       1019
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1244998806"
     variation       1020
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1335090690"
     variation       1022
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1397930871"
     variation       1026
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1490208407"
     variation       1027
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1586476152"
     variation       1029
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777113684"
     variation       1036
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1270948530"
     variation       1037
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1336102967"
     variation       1041..1046
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ctc"
                     /replace="ctcctc"
                     /db_xref="dbSNP:750747373"
     variation       1041
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746575607"
     variation       1045
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148676795"
     variation       1050
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414778258"
     variation       1052..1077
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="ctttccc"
                     /replace="ctttccctgagggggaagtctttccc"
                     /db_xref="dbSNP:1242917586"
     variation       1057
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142141895"
     variation       1059
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745822635"
     variation       1060
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769533326"
     variation       1061
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1362918397"
     variation       1061
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:564660017"
     variation       1062..1066
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:545756863"
     variation       1064
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1405021525"
     variation       1065
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1304490636"
     variation       1066
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775485125"
     variation       1068
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768973800"
     variation       1070
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:774283454"
     variation       1072
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762017742"
     variation       1074
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1225615571"
     variation       1075
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:767497872"
     variation       1076
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773796757"
     variation       1078
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761284971"
     variation       1080
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:766888634"
     variation       1083
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766805368"
     variation       1086
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:397839847"
     variation       1087
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931169399"
     variation       1090
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:571772325"
     variation       1092
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868556173"
     variation       1095
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1179964179"
     variation       1096
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:763861496"
     variation       1098..1100
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:754368664"
     variation       1100
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751178428"
     variation       1106
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1368197172"
     variation       1107
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247281391"
     variation       1112
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1338878913"
     variation       1120
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1408655681"
     variation       1121
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756736362"
     variation       1126
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780707684"
     variation       1127
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745769186"
     variation       1130
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756085416"
     variation       1131
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1382272774"
     variation       1133
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1319112017"
     variation       1136
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247034845"
     variation       1142
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1317192950"
     variation       1143
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779804055"
     variation       1144..1161
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="gggga"
                     /replace="ggggaacaggggagggga"
                     /db_xref="dbSNP:920588496"
     variation       1147
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373454446"
     variation       1148
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749166599"
     variation       1150
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:187298898"
     variation       1151..1152
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:755512421"
     variation       1151
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774564179"
     variation       1153
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371237720"
     variation       1154
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1563684745"
     variation       1159
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772229313"
     variation       1162
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382963449"
     variation       1163
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1242340775"
     variation       1170
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444822632"
     variation       1175
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182501314"
     variation       1179
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1449532795"
     variation       1181
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:943769340"
     variation       1184
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489517123"
     variation       1190
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1586476305"
     variation       1193
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9297754"
     variation       1194
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290361391"
     variation       1197
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1211375726"
     variation       1198
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1357602653"
     variation       1205
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78695295"
     variation       1208..1209
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1229299430"
     variation       1210
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1367433635"
     variation       1212
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549402782"
     variation       1216
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1184008109"
     variation       1219
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1563684772"
     variation       1220
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050662777"
     variation       1225
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1411895323"
     variation       1233
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325982925"
     variation       1236
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1403932825"
     variation       1238
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1586476351"
     variation       1241
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1586476354"
     variation       1243
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423522094"
     variation       1244
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:563132584"
     variation       1245
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162533647"
     variation       1246
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9297755"
     variation       1250
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362544797"
     variation       1252
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:890437832"
     variation       1253
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421398146"
     variation       1255
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1296291609"
     variation       1256
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1165605903"
     variation       1257
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78931371"
     variation       1259
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182512875"
     variation       1260
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1200791467"
     variation       1261
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:956794271"
     variation       1263
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1268529530"
     variation       1270
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1206139773"
     variation       1287
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1344513286"
     variation       1297
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1270996985"
     variation       1299
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1304430154"
     variation       1301
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534247326"
     variation       1310..1311
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1227388108"
     variation       1313
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277108162"
     variation       1321
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547856508"
     variation       1325..1330
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="catcat"
                     /replace="catcatcat"
                     /db_xref="dbSNP:1355251022"
     variation       1328
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1563684805"
     variation       1329..1330
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:1345281698"
     variation       1330
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308956672"
     variation       1331
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1237384351"
     variation       1332
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371982599"
     variation       1338
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1285888778"
     variation       1343
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1326331601"
     variation       1344
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1443569707"
     variation       1345
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188074125"
     variation       1347
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1236104099"
     variation       1348
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1483010887"
     variation       1349
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1179530177"
     variation       1350
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:943463276"
     variation       1351..1353
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="aaa"
                     /db_xref="dbSNP:1174239054"
     variation       1354
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1586476432"
     variation       1358
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1382198402"
     variation       1359
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3179559"
     variation       1365
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1437882921"
     variation       1366
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1203987069"
     variation       1367
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192359771"
     variation       1369..1370
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="a"
                     /replace="aaaa"
                     /db_xref="dbSNP:1563684833"
     variation       1369
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1407143549"
     variation       1370..1371
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="g"
                     /replace="ta"
                     /replace="taaaa"
                     /replace="taaaaaa"
                     /db_xref="dbSNP:rs1253583002"
     variation       1370
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1323394437"
     variation       1370
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:199935435"
     variation       1371..1386
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="aaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs71303488"
     variation       1371
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:868125972"
     variation       1378
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:556160013"
     variation       1379
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172021598"
     variation       1382..1384
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="aaa"
                     /replace="aaagaaa"
                     /db_xref="dbSNP:1177884440"
     variation       1382..1383
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1473216454"
     variation       1382
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200889381"
     variation       1383..1384
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="g"
                     /replace="gaaag"
                     /replace="gaag"
                     /db_xref="dbSNP:1554608611"
     variation       1383..1384
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="aa"
                     /replace="aagaa"
                     /db_xref="dbSNP:1554608605"
     variation       1383
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="aga"
                     /db_xref="dbSNP:1563684854"
     variation       1383
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368932899"
     variation       1384..1386
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="aaa"
                     /replace="aaaaaagaaa"
                     /replace="aaaagaaa"
                     /db_xref="dbSNP:1554608616"
     variation       1384..1385
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="aa"
                     /replace="aagaa"
                     /replace="aagaaagaa"
                     /db_xref="dbSNP:1554608612"
     variation       1384
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="aga"
                     /replace="agaaaaaga"
                     /replace="agaaaaga"
                     /replace="agaaaga"
                     /db_xref="dbSNP:rs1461298145"
     variation       1385
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969446054"
     variation       1386
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OCT4PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74548710"
ORIGIN      
ctcatttcaccaggcccccggcttggggcgccttccttccccatggcgggacacctggcttcggatttcgccttctcgccccctccaggcggtgggggtgatgggccatggggggcggagccgggctgggttgatcctctgacctggctaagcttccaaggccctcctggagggccaggaatcgggccgggggttgggccaggctctgaggtgtgggggattcccccttgccccccgccgtatgagttatgtggggggatggcgtactgtgggcctcaggttggagtggggctagtgccccaaggcggcttggagacctctcagcctgagagcgaagcaggagtcggggtggagagcaactccaatggggcctccccggaaccctgcaccgtcccccctggtgccgtgaagctggagaaggagaagctagagcaaaacccggagaagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcatcctgggggttctatttgggaaggtgttcagccaaaagaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcatgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctccggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcagtccctttccctgagggggaagtctttcccccagtctccgtcatcactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatggggaacaggggaggggaggagctagggaaagagaacctggagtttgtggcagggcttttgggattaagttcttcattcactaaggaaggaattgggaacactaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]