GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-08 15:20:27, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001135607             908 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3),
            mRNA.
ACCESSION   NM_001135607
VERSION     NM_001135607.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ058651.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058651.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760384, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..908
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..908
                     /gene="Rhox3"
                     /note="reproductive homeobox on X chromosome 3"
                     /db_xref="GeneID:100190895"
                     /db_xref="RGD:2301305"
     exon            1..400
                     /gene="Rhox3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    361..363
                     /gene="Rhox3"
                     /note="upstream in-frame stop codon"
     CDS             385..861
                     /gene="Rhox3"
                     /note="rhox homeobox family member 1-like"
                     /codon_start=1
                     /product="reproductive homeobox on X chromosome 3"
                     /protein_id="NP_001129079.1"
                     /db_xref="GeneID:100190895"
                     /db_xref="RGD:2301305"
                     /translation="
MDSTQGTKVLLTEEGRNEEDRGQGEPAMGATAAKVRVIKELNREGPAAGTAGLVDTDVNKEDGGANGGQKNEQQLKEPIPEHAEGKSVQSVPRQVPRRRLRHRFTQWQLEELESIFKANCFLSVEARKQLARWMGVTEAIVKRWFRKRREQYRRYKRL"
     misc_feature    676..846
                     /gene="Rhox3"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            401..764
                     /gene="Rhox3"
                     /inference="alignment:Splign:2.1.0"
     exon            765..810
                     /gene="Rhox3"
                     /inference="alignment:Splign:2.1.0"
     exon            811..908
                     /gene="Rhox3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cttaatcctctcaaataggctcttataattgaccactatcccttccctaggaagataattcaccaaagtcagaggactcagctgagatgctgcttaaaaggccatttccgcatctctacttgcccaaggactgtgccctccctgaaaacacattctgtttatcacagcaccaaactgctctcactagggcacctcagggctcaatccatagcaacaggtgatgagcttgaagccagaacattacatctataactggacacatagtaatgtggaatgggctggaagaaatctcttccaggtcaagggtcactgcttctgctctattaccggaactacatcggaattaccagaggttccagttaattctacagatgtaaaactaaaatggacagcactcaaggtacaaaggttttgctgactgaagagggaagaaacgaggaagatagaggacagggcgagccggcaatgggagccacagcagcaaaagtgagagtaataaaagaattaaacagagagggtcctgctgctggcactgcaggccttgtagatacagacgtgaacaaggaagatggtggcgccaacggaggccagaagaatgagcagcaactgaaggagccgattcctgagcatgctgagggcaagagtgtccagtctgtgcctaggcaggtgccacgacgtcgactacgccatagattcacccagtggcagttggaggaactagagagcattttcaaggccaattgcttcctcagtgtagaagcaagaaaacaactggccagatggatgggtgtgactgaagccatagtgaagagatggtttcggaagaggagagaacaatacaggcgatataagaggctataaggtctctgaagttctcctgctttctagtacatttttccctggcaact
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]