GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 16:18:44, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001135260             644 bp    mRNA    linear   ROD 01-FEB-2021
DEFINITION  Rattus norvegicus transmembrane protein 167B (Tmem167b), mRNA.
ACCESSION   NM_001135260 XM_001071753 XM_575014
VERSION     NM_001135260.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 644)
  AUTHORS   Wendler F, Gillingham AK, Sinka R, Rosa-Ferreira C, Gordon DE,
            Franch-Marro X, Peden AA, Vincent JP and Munro S.
  TITLE     A genome-wide RNA interference screen identifies two novel
            components of the metazoan secretory pathway
  JOURNAL   EMBO J. 29 (2), 304-314 (2010)
   PUBMED   19942856
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473952.1.
            On or before Sep 29, 2008 this sequence version replaced
            XM_001071753.1, XM_575014.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CB608751.1, FQ137388.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..644
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="2"
                     /map="2q34"
     gene            1..644
                     /gene="Tmem167b"
                     /gene_synonym="RGD1564454"
                     /note="transmembrane protein 167B"
                     /db_xref="GeneID:499690"
                     /db_xref="RGD:1564454"
     exon            1..196
                     /gene="Tmem167b"
                     /gene_synonym="RGD1564454"
                     /inference="alignment:Splign:2.0.8"
     CDS             187..411
                     /gene="Tmem167b"
                     /gene_synonym="RGD1564454"
                     /codon_start=1
                     /product="protein kish-B"
                     /protein_id="NP_001128732.1"
                     /db_xref="GeneID:499690"
                     /db_xref="RGD:1564454"
                     /translation="
MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACIVMAFYVLFIK"
     misc_feature    217..324
                     /gene="Tmem167b"
                     /gene_synonym="RGD1564454"
                     /note="Protein of unknown function (DUF1242); Region:
                     DUF1242; pfam06842"
                     /db_xref="CDD:399673"
     exon            197..328
                     /gene="Tmem167b"
                     /gene_synonym="RGD1564454"
                     /inference="alignment:Splign:2.0.8"
     exon            329..644
                     /gene="Tmem167b"
                     /gene_synonym="RGD1564454"
                     /inference="alignment:Splign:2.0.8"
     STS             481..640
                     /gene="Tmem167b"
                     /gene_synonym="RGD1564454"
                     /standard_name="BM390539"
                     /db_xref="UniSTS:260786"
ORIGIN      
gtgcggcgtttctctctctctctctctctctctctctctctctctcggccctcgcgcttgcgtactacggctcgttcttgtcaccacggcccggatcgggaagtgtcaagtgggaaccaggttcccccgcctttgcagcctctacagctgaacccggacccctcacccgggccgggcactaccgccatgacgaacgtgtactccttggatgggattctggtgtttggtctgctctttgtttgcacctgtgcctacttcaagaaagtacctcgtctcaaaacctggctgctttcagagaagaagggagtttggggtgtattttacaaagctgctgtgattggaacccggctgcatgctgctgttgcaattgcctgcatcgtaatggccttttacgtcctgtttatcaaatgaattccaaaccatccagctcatcagctgccaacccaggggataaagatgaagaacttgtcggaaacctggacccagcataggagagttgagctaaaatcgtcagtgtccccaagatgacactgaagcgtctgcctgccacatgtggggaaaactcatggtcacaaacatttttgtttcaggggattccagaaagccaaccttttttgatctctgcattaatcagctcccagcag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]