2025-07-04 11:13:08, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001134735 869 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus TATA-box binding protein associated factor 10 (Taf10), mRNA. ACCESSION NM_001134735 VERSION NM_001134735.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 869) AUTHORS Iturbide A, Pascual-Reguant L, Fargas L, Cebria JP, Alsina B, Garcia de Herreros A and Peiro S. TITLE LOXL2 Oxidizes Methylated TAF10 and Controls TFIID-Dependent Genes during Neural Progenitor Differentiation JOURNAL Mol Cell 58 (5), 755-766 (2015) PUBMED 25959397 REFERENCE 2 (bases 1 to 869) AUTHORS Malkowska M, Kokoszynska K, Rychlewski L and Wyrwicz L. TITLE Structural bioinformatics of the general transcription factor TFIID JOURNAL Biochimie 95 (4), 680-691 (2013) PUBMED 23146842 REMARK Review article REFERENCE 3 (bases 1 to 869) AUTHORS Spedale G, Timmers HT and Pijnappel WW. TITLE ATAC-king the complexity of SAGA during evolution JOURNAL Genes Dev 26 (6), 527-541 (2012) PUBMED 22426530 REMARK Review article REFERENCE 4 (bases 1 to 869) AUTHORS Kamileri I, Karakasilioti I, Sideri A, Kosteas T, Tatarakis A, Talianidis I and Garinis GA. TITLE Defective transcription initiation causes postnatal growth failure in a mouse model of nucleotide excision repair (NER) progeria JOURNAL Proc Natl Acad Sci U S A 109 (8), 2995-3000 (2012) PUBMED 22323595 REFERENCE 5 (bases 1 to 869) AUTHORS Tatarakis A, Margaritis T, Martinez-Jimenez CP, Kouskouti A, Mohan WS 2nd, Haroniti A, Kafetzopoulos D, Tora L and Talianidis I. TITLE Dominant and redundant functions of TFIID involved in the regulation of hepatic genes JOURNAL Mol Cell 31 (4), 531-543 (2008) PUBMED 18722179 REFERENCE 6 (bases 1 to 869) AUTHORS Ogryzko VV, Kotani T, Zhang X, Schiltz RL, Howard T, Yang XJ, Howard BH, Qin J and Nakatani Y. TITLE Histone-like TAFs within the PCAF histone acetylase complex JOURNAL Cell 94 (1), 35-44 (1998) PUBMED 9674425 REFERENCE 7 (bases 1 to 869) AUTHORS Wieczorek E, Brand M, Jacq X and Tora L. TITLE Function of TAF(II)-containing complex without TBP in transcription by RNA polymerase II JOURNAL Nature 393 (6681), 187-191 (1998) PUBMED 9603525 REFERENCE 8 (bases 1 to 869) AUTHORS Verrier CS, Roodi N, Yee CJ, Bailey LR, Jensen RA, Bustin M and Parl FF. TITLE High-mobility group (HMG) protein HMG-1 and TATA-binding protein-associated factor TAF(II)30 affect estrogen receptor-mediated transcriptional activation JOURNAL Mol Endocrinol 11 (8), 1009-1019 (1997) PUBMED 9212049 REFERENCE 9 (bases 1 to 869) AUTHORS Mengus G, May M, Jacq X, Staub A, Tora L, Chambon P and Davidson I. TITLE Cloning and characterization of hTAFII18, hTAFII20 and hTAFII28: three subunits of the human transcription factor TFIID JOURNAL EMBO J 14 (7), 1520-1531 (1995) PUBMED 7729427 REFERENCE 10 (bases 1 to 869) AUTHORS Jacq X, Brou C, Lutz Y, Davidson I, Chambon P and Tora L. TITLE Human TAFII30 is present in a distinct TFIID complex and is required for transcriptional activation by the estrogen receptor JOURNAL Cell 79 (1), 107-117 (1994) PUBMED 7923369 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC168203.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC168203.1, CK471009.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-869 BC168203.1 1-869 FEATURES Location/Qualifiers source 1..869 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="1" /map="1q32" gene 1..869 /gene="Taf10" /note="TATA-box binding protein associated factor 10" /db_xref="GeneID:293345" /db_xref="RGD:1305907" exon 1..247 /gene="Taf10" /inference="alignment:Splign:2.1.0" CDS 16..672 /gene="Taf10" /note="TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor" /codon_start=1 /product="transcription initiation factor TFIID subunit 10" /protein_id="NP_001128207.1" /db_xref="GeneID:293345" /db_xref="RGD:1305907" /translation="
MSCSGSGADPEAAPACAASVAGPAPPVSAPAALPTSTAAESKASPAGTAGGPGAGVATAGTGPVAARAGEPAERRGPASVAAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT"
misc_feature 358..648 /gene="Taf10" /note="histone-fold domain found in transcription initiation factor TFIID subunit 10 (TAF10) and similar proteins; Region: HFD_TAF10; cd07982" /db_xref="CDD:467026" misc_feature order(358..363,370..375,379..384,391..408,415..420, 424..432,439..450,457..459,463..468,475..480,484..507, 511..519,523..528,535..537,589..606,613..615,625..627, 634..636) /gene="Taf10" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:467026" misc_feature order(424..426,433..450,457..459,463..465,499..501, 529..531,541..546) /gene="Taf10" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:467026" exon 248..402 /gene="Taf10" /inference="alignment:Splign:2.1.0" exon 403..467 /gene="Taf10" /inference="alignment:Splign:2.1.0" exon 468..582 /gene="Taf10" /inference="alignment:Splign:2.1.0" exon 583..752 /gene="Taf10" /inference="alignment:Splign:2.1.0" ORIGIN
tttcccaccagccccatgagctgcagcggctccggcgcggaccccgaggcggcgccagcctgtgccgcctcggtcgcgggtccggcgcccccggtgtccgctcccgctgcgctgcccactagcacggccgcggagagcaaagccagccccgcggggacagcagggggccctggagctggagtcgccactgcaggcacgggccccgtggcggcacgggcaggggagcccgcggagcggcgcggaccggcttcggtggcagcaggcggcgcggctccccctgagggggcaatgtctaacggggtttacgccctaccgagcgcggccaacggagaagtgaagcccgtagtgtccagcacaccactagtggacttcttgatgcagttggaggattatacacctacgatcccggatgcagtgactggttactacctgaaccgtgctggctttgaagcttcagacccacgcataattcggctcatctcactagctgcccagaaattcatctcagatattgccaatgatgccctacagcactgcaaaatgaagggtacagcctctggcagctcccggagcaagagcaaggatcgcaagtacaccctaaccatggaggacttgacccctgccctcagcgagtatggcatcaatgtgaagaagccgcactacttcacctgagccacccaacccagatgtatttgtcttcccctctgtccccacatgagcctgttttcataataaactttattgtgacaggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]