GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-07 06:34:58, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001134735             869 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus TATA-box binding protein associated factor 10
            (Taf10), mRNA.
ACCESSION   NM_001134735
VERSION     NM_001134735.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 869)
  AUTHORS   Iturbide A, Pascual-Reguant L, Fargas L, Cebria JP, Alsina B,
            Garcia de Herreros A and Peiro S.
  TITLE     LOXL2 Oxidizes Methylated TAF10 and Controls TFIID-Dependent Genes
            during Neural Progenitor Differentiation
  JOURNAL   Mol Cell 58 (5), 755-766 (2015)
   PUBMED   25959397
REFERENCE   2  (bases 1 to 869)
  AUTHORS   Malkowska M, Kokoszynska K, Rychlewski L and Wyrwicz L.
  TITLE     Structural bioinformatics of the general transcription factor TFIID
  JOURNAL   Biochimie 95 (4), 680-691 (2013)
   PUBMED   23146842
  REMARK    Review article
REFERENCE   3  (bases 1 to 869)
  AUTHORS   Spedale G, Timmers HT and Pijnappel WW.
  TITLE     ATAC-king the complexity of SAGA during evolution
  JOURNAL   Genes Dev 26 (6), 527-541 (2012)
   PUBMED   22426530
  REMARK    Review article
REFERENCE   4  (bases 1 to 869)
  AUTHORS   Kamileri I, Karakasilioti I, Sideri A, Kosteas T, Tatarakis A,
            Talianidis I and Garinis GA.
  TITLE     Defective transcription initiation causes postnatal growth failure
            in a mouse model of nucleotide excision repair (NER) progeria
  JOURNAL   Proc Natl Acad Sci U S A 109 (8), 2995-3000 (2012)
   PUBMED   22323595
REFERENCE   5  (bases 1 to 869)
  AUTHORS   Tatarakis A, Margaritis T, Martinez-Jimenez CP, Kouskouti A, Mohan
            WS 2nd, Haroniti A, Kafetzopoulos D, Tora L and Talianidis I.
  TITLE     Dominant and redundant functions of TFIID involved in the
            regulation of hepatic genes
  JOURNAL   Mol Cell 31 (4), 531-543 (2008)
   PUBMED   18722179
REFERENCE   6  (bases 1 to 869)
  AUTHORS   Ogryzko VV, Kotani T, Zhang X, Schiltz RL, Howard T, Yang XJ,
            Howard BH, Qin J and Nakatani Y.
  TITLE     Histone-like TAFs within the PCAF histone acetylase complex
  JOURNAL   Cell 94 (1), 35-44 (1998)
   PUBMED   9674425
REFERENCE   7  (bases 1 to 869)
  AUTHORS   Wieczorek E, Brand M, Jacq X and Tora L.
  TITLE     Function of TAF(II)-containing complex without TBP in transcription
            by RNA polymerase II
  JOURNAL   Nature 393 (6681), 187-191 (1998)
   PUBMED   9603525
REFERENCE   8  (bases 1 to 869)
  AUTHORS   Verrier CS, Roodi N, Yee CJ, Bailey LR, Jensen RA, Bustin M and
            Parl FF.
  TITLE     High-mobility group (HMG) protein HMG-1 and TATA-binding
            protein-associated factor TAF(II)30 affect estrogen
            receptor-mediated transcriptional activation
  JOURNAL   Mol Endocrinol 11 (8), 1009-1019 (1997)
   PUBMED   9212049
REFERENCE   9  (bases 1 to 869)
  AUTHORS   Mengus G, May M, Jacq X, Staub A, Tora L, Chambon P and Davidson I.
  TITLE     Cloning and characterization of hTAFII18, hTAFII20 and hTAFII28:
            three subunits of the human transcription factor TFIID
  JOURNAL   EMBO J 14 (7), 1520-1531 (1995)
   PUBMED   7729427
REFERENCE   10 (bases 1 to 869)
  AUTHORS   Jacq X, Brou C, Lutz Y, Davidson I, Chambon P and Tora L.
  TITLE     Human TAFII30 is present in a distinct TFIID complex and is
            required for transcriptional activation by the estrogen receptor
  JOURNAL   Cell 79 (1), 107-117 (1994)
   PUBMED   7923369
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC168203.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC168203.1, CK471009.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-869               BC168203.1         1-869
FEATURES             Location/Qualifiers
     source          1..869
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q32"
     gene            1..869
                     /gene="Taf10"
                     /note="TATA-box binding protein associated factor 10"
                     /db_xref="GeneID:293345"
                     /db_xref="RGD:1305907"
     exon            1..247
                     /gene="Taf10"
                     /inference="alignment:Splign:2.1.0"
     CDS             16..672
                     /gene="Taf10"
                     /note="TAF10 RNA polymerase II, TATA box binding protein
                     (TBP)-associated factor"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     10"
                     /protein_id="NP_001128207.1"
                     /db_xref="GeneID:293345"
                     /db_xref="RGD:1305907"
                     /translation="
MSCSGSGADPEAAPACAASVAGPAPPVSAPAALPTSTAAESKASPAGTAGGPGAGVATAGTGPVAARAGEPAERRGPASVAAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT"
     misc_feature    358..648
                     /gene="Taf10"
                     /note="histone-fold domain found in transcription
                     initiation factor TFIID subunit 10 (TAF10) and similar
                     proteins; Region: HFD_TAF10; cd07982"
                     /db_xref="CDD:467026"
     misc_feature    order(358..363,370..375,379..384,391..408,415..420,
                     424..432,439..450,457..459,463..468,475..480,484..507,
                     511..519,523..528,535..537,589..606,613..615,625..627,
                     634..636)
                     /gene="Taf10"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467026"
     misc_feature    order(424..426,433..450,457..459,463..465,499..501,
                     529..531,541..546)
                     /gene="Taf10"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467026"
     exon            248..402
                     /gene="Taf10"
                     /inference="alignment:Splign:2.1.0"
     exon            403..467
                     /gene="Taf10"
                     /inference="alignment:Splign:2.1.0"
     exon            468..582
                     /gene="Taf10"
                     /inference="alignment:Splign:2.1.0"
     exon            583..752
                     /gene="Taf10"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tttcccaccagccccatgagctgcagcggctccggcgcggaccccgaggcggcgccagcctgtgccgcctcggtcgcgggtccggcgcccccggtgtccgctcccgctgcgctgcccactagcacggccgcggagagcaaagccagccccgcggggacagcagggggccctggagctggagtcgccactgcaggcacgggccccgtggcggcacgggcaggggagcccgcggagcggcgcggaccggcttcggtggcagcaggcggcgcggctccccctgagggggcaatgtctaacggggtttacgccctaccgagcgcggccaacggagaagtgaagcccgtagtgtccagcacaccactagtggacttcttgatgcagttggaggattatacacctacgatcccggatgcagtgactggttactacctgaaccgtgctggctttgaagcttcagacccacgcataattcggctcatctcactagctgcccagaaattcatctcagatattgccaatgatgccctacagcactgcaaaatgaagggtacagcctctggcagctcccggagcaagagcaaggatcgcaagtacaccctaaccatggaggacttgacccctgccctcagcgagtatggcatcaatgtgaagaagccgcactacttcacctgagccacccaacccagatgtatttgtcttcccctctgtccccacatgagcctgttttcataataaactttattgtgacaggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]