ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-07 06:34:58, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001134735 869 bp mRNA linear ROD 22-MAR-2023
DEFINITION Rattus norvegicus TATA-box binding protein associated factor 10
(Taf10), mRNA.
ACCESSION NM_001134735
VERSION NM_001134735.1
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 869)
AUTHORS Iturbide A, Pascual-Reguant L, Fargas L, Cebria JP, Alsina B,
Garcia de Herreros A and Peiro S.
TITLE LOXL2 Oxidizes Methylated TAF10 and Controls TFIID-Dependent Genes
during Neural Progenitor Differentiation
JOURNAL Mol Cell 58 (5), 755-766 (2015)
PUBMED 25959397
REFERENCE 2 (bases 1 to 869)
AUTHORS Malkowska M, Kokoszynska K, Rychlewski L and Wyrwicz L.
TITLE Structural bioinformatics of the general transcription factor TFIID
JOURNAL Biochimie 95 (4), 680-691 (2013)
PUBMED 23146842
REMARK Review article
REFERENCE 3 (bases 1 to 869)
AUTHORS Spedale G, Timmers HT and Pijnappel WW.
TITLE ATAC-king the complexity of SAGA during evolution
JOURNAL Genes Dev 26 (6), 527-541 (2012)
PUBMED 22426530
REMARK Review article
REFERENCE 4 (bases 1 to 869)
AUTHORS Kamileri I, Karakasilioti I, Sideri A, Kosteas T, Tatarakis A,
Talianidis I and Garinis GA.
TITLE Defective transcription initiation causes postnatal growth failure
in a mouse model of nucleotide excision repair (NER) progeria
JOURNAL Proc Natl Acad Sci U S A 109 (8), 2995-3000 (2012)
PUBMED 22323595
REFERENCE 5 (bases 1 to 869)
AUTHORS Tatarakis A, Margaritis T, Martinez-Jimenez CP, Kouskouti A, Mohan
WS 2nd, Haroniti A, Kafetzopoulos D, Tora L and Talianidis I.
TITLE Dominant and redundant functions of TFIID involved in the
regulation of hepatic genes
JOURNAL Mol Cell 31 (4), 531-543 (2008)
PUBMED 18722179
REFERENCE 6 (bases 1 to 869)
AUTHORS Ogryzko VV, Kotani T, Zhang X, Schiltz RL, Howard T, Yang XJ,
Howard BH, Qin J and Nakatani Y.
TITLE Histone-like TAFs within the PCAF histone acetylase complex
JOURNAL Cell 94 (1), 35-44 (1998)
PUBMED 9674425
REFERENCE 7 (bases 1 to 869)
AUTHORS Wieczorek E, Brand M, Jacq X and Tora L.
TITLE Function of TAF(II)-containing complex without TBP in transcription
by RNA polymerase II
JOURNAL Nature 393 (6681), 187-191 (1998)
PUBMED 9603525
REFERENCE 8 (bases 1 to 869)
AUTHORS Verrier CS, Roodi N, Yee CJ, Bailey LR, Jensen RA, Bustin M and
Parl FF.
TITLE High-mobility group (HMG) protein HMG-1 and TATA-binding
protein-associated factor TAF(II)30 affect estrogen
receptor-mediated transcriptional activation
JOURNAL Mol Endocrinol 11 (8), 1009-1019 (1997)
PUBMED 9212049
REFERENCE 9 (bases 1 to 869)
AUTHORS Mengus G, May M, Jacq X, Staub A, Tora L, Chambon P and Davidson I.
TITLE Cloning and characterization of hTAFII18, hTAFII20 and hTAFII28:
three subunits of the human transcription factor TFIID
JOURNAL EMBO J 14 (7), 1520-1531 (1995)
PUBMED 7729427
REFERENCE 10 (bases 1 to 869)
AUTHORS Jacq X, Brou C, Lutz Y, Davidson I, Chambon P and Tora L.
TITLE Human TAFII30 is present in a distinct TFIID complex and is
required for transcriptional activation by the estrogen receptor
JOURNAL Cell 79 (1), 107-117 (1994)
PUBMED 7923369
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BC168203.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC168203.1, CK471009.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA5760383, SAMEA5760389
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on conservation, expression,
longest protein
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-869 BC168203.1 1-869
FEATURES Location/Qualifiers
source 1..869
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="1"
/map="1q32"
gene 1..869
/gene="Taf10"
/note="TATA-box binding protein associated factor 10"
/db_xref="GeneID:293345"
/db_xref="RGD:1305907"
exon 1..247
/gene="Taf10"
/inference="alignment:Splign:2.1.0"
CDS 16..672
/gene="Taf10"
/note="TAF10 RNA polymerase II, TATA box binding protein
(TBP)-associated factor"
/codon_start=1
/product="transcription initiation factor TFIID subunit
10"
/protein_id="NP_001128207.1"
/db_xref="GeneID:293345"
/db_xref="RGD:1305907"
/translation="
MSCSGSGADPEAAPACAASVAGPAPPVSAPAALPTSTAAESKASPAGTAGGPGAGVATAGTGPVAARAGEPAERRGPASVAAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT"
misc_feature 358..648
/gene="Taf10"
/note="histone-fold domain found in transcription
initiation factor TFIID subunit 10 (TAF10) and similar
proteins; Region: HFD_TAF10; cd07982"
/db_xref="CDD:467026"
misc_feature order(358..363,370..375,379..384,391..408,415..420,
424..432,439..450,457..459,463..468,475..480,484..507,
511..519,523..528,535..537,589..606,613..615,625..627,
634..636)
/gene="Taf10"
/note="heterodimer interface [polypeptide binding]; other
site"
/db_xref="CDD:467026"
misc_feature order(424..426,433..450,457..459,463..465,499..501,
529..531,541..546)
/gene="Taf10"
/note="oligomer interface [polypeptide binding]; other
site"
/db_xref="CDD:467026"
exon 248..402
/gene="Taf10"
/inference="alignment:Splign:2.1.0"
exon 403..467
/gene="Taf10"
/inference="alignment:Splign:2.1.0"
exon 468..582
/gene="Taf10"
/inference="alignment:Splign:2.1.0"
exon 583..752
/gene="Taf10"
/inference="alignment:Splign:2.1.0"
ORIGIN
tttcccaccagccccatgagctgcagcggctccggcgcggaccccgaggcggcgccagcctgtgccgcctcggtcgcgggtccggcgcccccggtgtccgctcccgctgcgctgcccactagcacggccgcggagagcaaagccagccccgcggggacagcagggggccctggagctggagtcgccactgcaggcacgggccccgtggcggcacgggcaggggagcccgcggagcggcgcggaccggcttcggtggcagcaggcggcgcggctccccctgagggggcaatgtctaacggggtttacgccctaccgagcgcggccaacggagaagtgaagcccgtagtgtccagcacaccactagtggacttcttgatgcagttggaggattatacacctacgatcccggatgcagtgactggttactacctgaaccgtgctggctttgaagcttcagacccacgcataattcggctcatctcactagctgcccagaaattcatctcagatattgccaatgatgccctacagcactgcaaaatgaagggtacagcctctggcagctcccggagcaagagcaaggatcgcaagtacaccctaaccatggaggacttgacccctgccctcagcgagtatggcatcaatgtgaagaagccgcactacttcacctgagccacccaacccagatgtatttgtcttcccctctgtccccacatgagcctgttttcataataaactttattgtgacaggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]