LOCUS       NM_001111318             663 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus claudin 24 (Cldn24), mRNA.
ACCESSION   NM_001111318 XM_001473536
VERSION     NM_001111318.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 663)
  AUTHORS   Higashi AY, Higashi T, Furuse K, Ozeki K, Furuse M and Chiba H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 663)
  AUTHORS   Westmoreland JJ, Drosos Y, Kelly J, Ye J, Means AL, Washington MK
            and Sosa-Pineda B.
  TITLE     Dynamic distribution of claudin proteins in pancreatic epithelia
            undergoing morphogenesis or neoplastic transformation
  JOURNAL   Dev Dyn 241 (3), 583-594 (2012)
   PUBMED   22275141
REFERENCE   3  (bases 1 to 663)
  AUTHORS   Mineta K, Yamamoto Y, Yamazaki Y, Tanaka H, Tada Y, Saito K, Tamura
            A, Igarashi M, Endo T, Takeuchi K and Tsukita S.
  TITLE     Predicted expansion of the claudin multigene family
  JOURNAL   FEBS Lett 585 (4), 606-612 (2011)
   PUBMED   21276448
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CH466554.1.
            
            On Dec 14, 2007 this sequence version replaced XM_001473536.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is 75%
            identical to the human homolog. Similar to the human gene, this
            gene is upstream of the Cldn22 gene, which overlaps the Wwc2 gene
            on the opposite strand. [provided by RefSeq, Aug 2010].
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="mixed"
                     /db_xref="taxon:10090"
                     /chromosome="8"
                     /map="8 26.91 cM"
     gene            1..663
                     /gene="Cldn24"
                     /gene_synonym="Gm10107"
                     /note="claudin 24"
                     /db_xref="GeneID:100039801"
                     /db_xref="MGI:MGI:3712484"
     CDS             1..663
                     /gene="Cldn24"
                     /gene_synonym="Gm10107"
                     /codon_start=1
                     /product="putative claudin-24"
                     /protein_id="NP_001104788.1"
                     /db_xref="CCDS:CCDS52549.1"
                     /db_xref="GeneID:100039801"
                     /db_xref="MGI:MGI:3712484"
                     /translation="

MAFIFRTAMQSVGLSLSLLGWVLAIITTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACSSPAPAASSHYAGAGPRDHGSYLENGTVQPKV"

     misc_feature    19..549
                     /gene="Cldn24"
                     /gene_synonym="Gm10107"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
     exon            1..663
                     /gene="Cldn24"
                     /gene_synonym="Gm10107"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atggctttcatcttcagaacggccatgcaatcagtagggctttctctgtcattgctgggatgggttctagccattattaccacatatctaccacactggaagaaccttaacttggagctgaacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcaggtctccagggtcttgatgtccctgtgcaacgggctggggctgctgggcttgctggcctctggctgtggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcggctgctcaccctgggagggaccctgctctggacctcgggagtcatggtgctagttcctgtctcctgggtggcccacaagacggtgcgggagttctgggatgagaccatgcctgagattgtgcccaggtgggagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgctaggagggtgtgtgcttcactgtgcagcctgctcgagcccagctcctgcagcctcgagtcactatgcaggggcgggacctcgagatcatggttcatacctagaaaatggaactgtacagcctaaagtgtaa

//