GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:26:00, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001110822            1623 bp    mRNA    linear   PRI 08-MAR-2020
DEFINITION  Homo sapiens tudor domain containing 12 (TDRD12), transcript
            variant 2, mRNA.
ACCESSION   NM_001110822 XM_001713629 XM_001713630 XM_001713631
VERSION     NM_001110822.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1623)
  AUTHORS   Babakhanzadeh E, Khodadadian A, Rostami S, Alipourfard I, Aghaei M,
            Nazari M, Hosseinnia M, Mehrjardi MYV, Jamshidi Y and Ghasemi N.
  TITLE     Testicular expression of TDRD1, TDRD5, TDRD9 and TDRD12 in
            azoospermia
  JOURNAL   BMC Med. Genet. 21 (1), 33 (2020)
   PUBMED   32059713
  REMARK    GeneRIF: Here we evaluate gene and protein expression levels of
            four key TDRDs (TDRD1, TDRD5, TDRD9 and TDRD12) in testicular
            biopsy samples obtained from men with obstructive azoospermia (OA,
            n = 29), as controls, and various types of non-obstructive
            azoospermia containing hypospermatogenesis (HP, 28), maturation
            arrest (MA, n = 30), and Sertoli cell-only syndrome (SCOS, n = 32)
            as cases.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1623)
  AUTHORS   Hasson SA, Kane LA, Yamano K, Huang CH, Sliter DA, Buehler E, Wang
            C, Heman-Ackah SM, Hessa T, Guha R, Martin SE and Youle RJ.
  TITLE     High-content genome-wide RNAi screens identify regulators of parkin
            upstream of mitophagy
  JOURNAL   Nature 504 (7479), 291-295 (2013)
   PUBMED   24270810
REFERENCE   3  (bases 1 to 1623)
  AUTHORS   Kottgen A, Pattaro C, Boger CA, Fuchsberger C, Olden M, Glazer NL,
            Parsa A, Gao X, Yang Q, Smith AV, O'Connell JR, Li M, Schmidt H,
            Tanaka T, Isaacs A, Ketkar S, Hwang SJ, Johnson AD, Dehghan A,
            Teumer A, Pare G, Atkinson EJ, Zeller T, Lohman K, Cornelis MC,
            Probst-Hensch NM, Kronenberg F, Tonjes A, Hayward C, Aspelund T,
            Eiriksdottir G, Launer LJ, Harris TB, Rampersaud E, Mitchell BD,
            Arking DE, Boerwinkle E, Struchalin M, Cavalieri M, Singleton A,
            Giallauria F, Metter J, de Boer IH, Haritunians T, Lumley T,
            Siscovick D, Psaty BM, Zillikens MC, Oostra BA, Feitosa M, Province
            M, de Andrade M, Turner ST, Schillert A, Ziegler A, Wild PS,
            Schnabel RB, Wilde S, Munzel TF, Leak TS, Illig T, Klopp N,
            Meisinger C, Wichmann HE, Koenig W, Zgaga L, Zemunik T, Kolcic I,
            Minelli C, Hu FB, Johansson A, Igl W, Zaboli G, Wild SH, Wright AF,
            Campbell H, Ellinghaus D, Schreiber S, Aulchenko YS, Felix JF,
            Rivadeneira F, Uitterlinden AG, Hofman A, Imboden M, Nitsch D,
            Brandstatter A, Kollerits B, Kedenko L, Magi R, Stumvoll M, Kovacs
            P, Boban M, Campbell S, Endlich K, Volzke H, Kroemer HK, Nauck M,
            Volker U, Polasek O, Vitart V, Badola S, Parker AN, Ridker PM,
            Kardia SL, Blankenberg S, Liu Y, Curhan GC, Franke A, Rochat T,
            Paulweber B, Prokopenko I, Wang W, Gudnason V, Shuldiner AR, Coresh
            J, Schmidt R, Ferrucci L, Shlipak MG, van Duijn CM, Borecki I,
            Kramer BK, Rudan I, Gyllensten U, Wilson JF, Witteman JC,
            Pramstaller PP, Rettig R, Hastie N, Chasman DI, Kao WH, Heid IM and
            Fox CS.
  TITLE     New loci associated with kidney function and chronic kidney disease
  JOURNAL   Nat. Genet. 42 (5), 376-384 (2010)
   PUBMED   20383146
REFERENCE   4  (bases 1 to 1623)
  AUTHORS   Mitsui K, Tokuzawa Y, Itoh H, Segawa K, Murakami M, Takahashi K,
            Maruyama M, Maeda M and Yamanaka S.
  TITLE     The homeoprotein Nanog is required for maintenance of pluripotency
            in mouse epiblast and ES cells
  JOURNAL   Cell 113 (5), 631-642 (2003)
   PUBMED   12787504
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC008736.6, BC049000.1 and AB211063.1.
            On Jun 2, 2019 this sequence version replaced NM_001110822.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA1968968,
                              SAMEA2148093 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-6                 AC008736.6         85093-85098         c
            7-8                 BC049000.1         1-2
            9-9                 AC008736.6         85090-85090         c
            10-747              BC049000.1         4-741
            748-1623            AB211063.1         424-1299
FEATURES             Location/Qualifiers
     source          1..1623
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.11"
     gene            1..1623
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /note="tudor domain containing 12"
                     /db_xref="GeneID:91646"
                     /db_xref="HGNC:HGNC:25044"
     exon            1..330
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       9
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1353110324"
     variation       10
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1178958696"
     variation       11
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:976098191"
     variation       13
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:973810702"
     variation       14
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1424393052"
     variation       15
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441584818"
     variation       16..18
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1251573554"
     variation       16
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:914174961"
     variation       20
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599809604"
     variation       22
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:920641621"
     variation       23
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945648891"
     variation       24
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1044286754"
     variation       26
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1279034437"
     variation       27
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760102786"
     variation       31..39
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="gcgggaggc"
                     /replace="gcgggaggcgggaggc"
                     /db_xref="dbSNP:983337777"
     variation       32
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1318177813"
     variation       33
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937776777"
     variation       35
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:548316611"
     variation       36
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1304904074"
     variation       40
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540471250"
     variation       42
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774524659"
     variation       44
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421658408"
     variation       45
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1364452748"
     variation       46
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:949872257"
     variation       50
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114717541"
     variation       52
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485852383"
     variation       55
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1013702514"
     variation       56
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1361974481"
     variation       62
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1036696579"
     variation       63
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1342785946"
     variation       64
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1260793608"
     variation       66
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1402380213"
     variation       69
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1289898075"
     variation       72
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294705444"
     variation       74
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:532446274"
     variation       77
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866817127"
     variation       81
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1311598550"
     variation       87
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384416033"
     variation       92
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1303933259"
     variation       93
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1026830478"
     variation       97
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891462260"
     variation       98
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1351867054"
     variation       99
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1283956901"
     variation       100
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1475419312"
     variation       103
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1416809267"
     variation       107
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:953833882"
     variation       114
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1430220676"
     variation       116
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1006708825"
     variation       117
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1489280080"
     variation       118
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1217438330"
     variation       119
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042675513"
     variation       126
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1487476819"
     variation       127
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017732426"
     variation       132
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1192685500"
     variation       138
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:551451937"
     variation       141
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:890740694"
     variation       143
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966111864"
     variation       144
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1425651740"
     variation       146
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009051404"
     variation       149
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599809861"
     variation       154..169
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="gggcacctgccgcggg"
                     /replace="gggcacctgccgcgggcacctgccgcggg"
                     /db_xref="dbSNP:1327499661"
     variation       156
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:976530778"
     variation       158
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1599809876"
     variation       159
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1156516716"
     variation       163
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1017811808"
     variation       164
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381791156"
     variation       166
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:913866525"
     variation       167..172
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="ggggg"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:1326828695"
     variation       168
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:967373244"
     variation       172
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1419734520"
     variation       175
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:979680144"
     variation       176
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:925474855"
     variation       179
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:938209401"
     variation       180
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373599639"
     variation       181
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:571331033"
     variation       197
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75585075"
     variation       198
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426225716"
     variation       201
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349791351"
     variation       204
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1193938419"
     variation       205
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467735988"
     variation       206
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599809963"
     variation       208
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1271706525"
     variation       213..217
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1435004137"
     variation       213
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:550644768"
     variation       217
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599809987"
     variation       218
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251254719"
     variation       221
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372256105"
     variation       223
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1037110650"
     variation       224
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896788013"
     variation       225
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1024156380"
     variation       226
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:971324812"
     variation       227
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307271303"
     variation       228
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:931239567"
     variation       229
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1392935942"
     variation       230
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567459981"
     variation       233
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935709548"
     variation       239
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:989933936"
     variation       240
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:867698056"
     variation       242
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889696007"
     variation       243
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194645936"
     variation       248
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945681418"
     variation       249
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1319822758"
     variation       251
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1006764519"
     variation       252
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150315126"
     variation       255
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901929712"
     variation       260
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553533749"
     variation       261
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1225897886"
     variation       263..264
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="ac"
                     /replace="acac"
                     /db_xref="dbSNP:766713593"
     variation       264
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1431692077"
     variation       266
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1178899571"
     variation       267
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1406889477"
     variation       270
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765743936"
     variation       272
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1329904603"
     variation       273
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753133001"
     variation       274
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:966712554"
     variation       275
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1568438792"
     variation       276..280
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1313360445"
     variation       277
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1274660173"
     variation       278
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433574640"
     variation       280
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:979824225"
     variation       285
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032589316"
     variation       289
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224936663"
     variation       291
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1285902409"
     variation       294
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:944976183"
     variation       297
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959612194"
     variation       298
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567010604"
     variation       302
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1274952321"
     variation       303
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778425234"
     CDS             307..1494
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /EC_number="3.6.4.13"
                     /note="isoform 2 is encoded by transcript variant 2; tudor
                     domain-containing protein 12; ES cell associated
                     transcript 8; ES cell-associated transcript 8 protein;
                     putative ATP-dependent RNA helicase TDRD12"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase TDRD12
                     isoform 2"
                     /protein_id="NP_001104292.1"
                     /db_xref="CCDS:CCDS46038.1"
                     /db_xref="GeneID:91646"
                     /db_xref="HGNC:HGNC:25044"
                     /translation="
MLQLLVLKIEDPGCFWVIIKGCSPFLDHDVDYQKLNSAMNDFYNSTCQDIEIKPLTLEEGQVCVVYCEELKCWCRAIVKSITSSADQYLAECFLVDFAKNIPVKSKNIRVVVESFMQLPYRAKKFSLYCTKPVTLHIDFCRDSTDIVPAKKWDNAAIQYFQNLLKATTQVEARLCAVEEDTFEVYLYVTIKDEKVCVNDDLVAKNYACYMSPTKNKNLDYLEKPRLNIKSAPSFNKLNPALTLWPMFLQGKDVQGMEDSHGVNFPAQSLQHTWCKGIVGDLRPTATAQDKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIYADPDVPEASALSQKSNEKPLRLTEKKEYDEKNSCVKLLQFLNPDPLRADGISDLQQT"
     misc_feature    334..690
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /note="Tudor domain; Region: TUDOR; pfam00567"
                     /db_xref="CDD:278965"
     misc_feature    484..633
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /note="Tudor domains are found in many eukaryotic
                     organisms and have been implicated in protein-protein
                     interactions in which methylated protein substrates bind
                     to these domains. For example, the Tudor domain of
                     Survival of Motor Neuron (SMN) binds to...; Region: TUDOR;
                     cd04508"
                     /db_xref="CDD:119391"
     misc_feature    order(505..507,520..522,526..528,592..594,601..603)
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /note="dimethylated arginine/lysine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:119391"
     variation       309
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220503983"
     variation       311
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1363632397"
     variation       312
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1568438878"
     variation       316
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1244732171"
     variation       318
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:539331063"
     variation       320
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:995309735"
     variation       322
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:918050973"
     variation       323
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:756772182"
     variation       325
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1477499128"
     variation       325
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1168640813"
     variation       327
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422215747"
     variation       328
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1411050110"
     variation       330
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568438916"
     exon            331..489
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       333
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1381154578"
     variation       341
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1158212108"
     variation       342
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1418345903"
     variation       344
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1203595337"
     variation       353
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1462360161"
     variation       363
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286685357"
     variation       364
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1447586209"
     variation       365
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1405518575"
     variation       367
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186946699"
     variation       368
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241780478"
     variation       371
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1447006105"
     variation       375
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770958907"
     variation       376
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1380052120"
     variation       377
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1599831446"
     variation       379..383
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1483524118"
     variation       382
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1418317679"
     variation       383
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256663508"
     variation       392
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:903701334"
     variation       393
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776748217"
     variation       396
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758674874"
     variation       397
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:937793522"
     variation       400
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1444789776"
     variation       404
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1315545161"
     variation       410
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1384855534"
     variation       412
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549129330"
     variation       417
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1055891205"
     variation       418
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1308514622"
     variation       421
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769317208"
     variation       427
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938223090"
     variation       438
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:894558713"
     variation       439
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1281429294"
     variation       440
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759484047"
     variation       443
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750956233"
     variation       444
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1350688691"
     variation       447
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1199898377"
     variation       450
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1288581492"
     variation       451
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1261302941"
     variation       452
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1462749581"
     variation       454
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227429975"
     variation       467
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1204849438"
     variation       469
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1238170374"
     variation       473
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1417636024"
     variation       475
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1014296688"
     variation       477
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166680257"
     variation       478..484
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="gaag"
                     /replace="gaagaag"
                     /db_xref="dbSNP:777317686"
     variation       481
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1213847510"
     variation       486
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:893931422"
     variation       488
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765587283"
     exon            490..626
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       490
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1038900627"
     variation       494
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1196825700"
     variation       495
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1420376757"
     variation       497
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1431062401"
     variation       503
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763035532"
     variation       516
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566004040"
     variation       523
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1371224353"
     variation       524
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377392020"
     variation       526
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298726789"
     variation       527
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172128747"
     variation       530..532
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1568449911"
     variation       533
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329911362"
     variation       539
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389732114"
     variation       543
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402942200"
     variation       545
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1301453470"
     variation       551
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767866241"
     variation       552
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377114275"
     variation       558
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020882615"
     variation       559
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305879579"
     variation       560
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966565397"
     variation       561
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230238226"
     variation       563
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1004996786"
     variation       565
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868134644"
     variation       571
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1252472766"
     variation       573
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199327110"
     variation       579
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1357041038"
     variation       585
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1037250670"
     variation       587
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1256381806"
     variation       589
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201742920"
     variation       593
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1220731349"
     variation       595..597
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="t"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1270529223"
     variation       597
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:926051759"
     variation       599
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192530648"
     variation       601
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1003642761"
     variation       603
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033790898"
     variation       609
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1259024828"
     variation       613
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369906127"
     variation       617
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1171053572"
     variation       622
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1332835106"
     variation       625
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775930306"
     exon            627..746
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       628
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221667883"
     variation       629
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1186605716"
     variation       631
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255326436"
     variation       632
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442740651"
     variation       634
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1185387586"
     variation       637
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191078032"
     variation       640
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258798258"
     variation       647
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:758871426"
     variation       647
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:865942933"
     variation       648
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:891751891"
     variation       649..651
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1335137120"
     variation       652
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1289552218"
     variation       655
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405488952"
     variation       657
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1169002868"
     variation       658
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756668790"
     variation       662
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772982873"
     variation       665
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:956029772"
     variation       666
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116197390"
     variation       678
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1413253149"
     variation       679
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1416014188"
     variation       681
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769932940"
     variation       683
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:946768789"
     variation       686
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304339962"
     variation       687
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1242366462"
     variation       689
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775908730"
     variation       691
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215834473"
     variation       694
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:763261904"
     variation       699
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866604788"
     variation       703
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459628583"
     variation       708
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1396271728"
     variation       716
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1205471639"
     variation       717..718
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="aaa"
                     /db_xref="dbSNP:1568453029"
     variation       717
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568453027"
     variation       727
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985400041"
     variation       728
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540825045"
     variation       730
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182809077"
     variation       734
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:962610538"
     variation       737
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1338197076"
     variation       740
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1175283314"
     variation       741
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1406007694"
     variation       743..744
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1421070073"
     exon            747..802
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       747
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1479463376"
     variation       749
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000111922"
     variation       751
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1178706230"
     variation       758
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1430558940"
     variation       760
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409865209"
     variation       761
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1169016982"
     variation       764
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1380838050"
     variation       767
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200157515"
     variation       768
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376879858"
     variation       770
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1302073116"
     variation       771
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388035281"
     variation       772
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:955845538"
     variation       775
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:539123407"
     variation       776..789
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="ttcag"
                     /replace="ttcagtactttcag"
                     /db_xref="dbSNP:1451553320"
     variation       776..777
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:780900314"
     variation       779
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406198988"
     variation       781
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370192431"
     variation       782
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:570756261"
     variation       792
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1338232882"
     variation       796
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753531553"
     variation       800
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1275111494"
     variation       802
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929792658"
     exon            803..888
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       805
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201268108"
     variation       812
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:761693362"
     variation       814
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001784176"
     variation       817
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1289285071"
     variation       818
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:879223445"
     variation       819
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448235565"
     variation       820
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1361391547"
     variation       826
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1283898774"
     variation       827
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1224990115"
     variation       828
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:766473942"
     variation       829
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290945359"
     variation       830
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1446436314"
     variation       842
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1213756089"
     variation       843
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1329159718"
     variation       844
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568457933"
     variation       847
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7260392"
     variation       850
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:539771484"
     variation       852
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466171515"
     variation       855
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768955406"
     variation       858
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1383755815"
     variation       859
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774371409"
     variation       861
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1163750694"
     variation       872
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1395404873"
     variation       874
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1038047346"
     variation       875
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1383805193"
     variation       880
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1398400816"
     exon            889..1078
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       889
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001686345"
     variation       893
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753366004"
     variation       897..900
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="t"
                     /replace="taat"
                     /db_xref="dbSNP:769920837"
     variation       899
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754053658"
     variation       904
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764943990"
     variation       907
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1423246146"
     variation       909
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209406555"
     variation       910
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1392569530"
     variation       914
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757309087"
     variation       921
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1408230961"
     variation       925
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1011617950"
     variation       926
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1453040431"
     variation       931
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1240785666"
     variation       932
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1327974679"
     variation       935
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779079344"
     variation       939
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149773815"
     variation       940
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:553356119"
     variation       941
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967385364"
     variation       945..947
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1599863471"
     variation       945
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1008081887"
     variation       950
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1019504812"
     variation       951
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:773194131"
     variation       952..956
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1357121071"
     variation       955
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432949151"
     variation       957
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745807381"
     variation       960
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1326319611"
     variation       963..964
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:879104217"
     variation       964
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:751585969"
     variation       971
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1375537363"
     variation       976
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1268250647"
     variation       980
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1238750733"
     variation       985
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200321834"
     variation       995
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:267605413"
     variation       999
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1331358912"
     variation       1001
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1301918339"
     variation       1004
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1436490866"
     variation       1011
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991907749"
     variation       1014
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1402571177"
     variation       1017
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371930364"
     variation       1018
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184972304"
     variation       1021
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1387298716"
     variation       1022
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479791646"
     variation       1023
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961322928"
     variation       1024
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431302520"
     variation       1025..1034
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="cact"
                     /replace="cacttacact"
                     /db_xref="dbSNP:1409934357"
     variation       1030
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1417780266"
     variation       1031
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772202882"
     variation       1037
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:975240219"
     variation       1042
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:781238095"
     variation       1045
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:973737724"
     variation       1049
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197609754"
     variation       1051
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868658602"
     variation       1058
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919758554"
     variation       1063
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252680909"
     variation       1067
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1205760845"
     variation       1075
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:952493997"
     exon            1079..1171
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       1080
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1463283540"
     variation       1081
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1568461792"
     variation       1085
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1169019113"
     variation       1088
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768561546"
     variation       1092..1094
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:768068404"
     variation       1098
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1301587045"
     variation       1100
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75257288"
     variation       1101
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748318198"
     variation       1106
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:921316854"
     variation       1107
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772530801"
     variation       1109
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329890348"
     variation       1110
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325225306"
     variation       1111
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230024661"
     variation       1118
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:932758733"
     variation       1122
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298760762"
     variation       1123
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:768873670"
     variation       1127
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368050411"
     variation       1129
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1048384571"
     variation       1133
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1293493424"
     variation       1138
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760980910"
     variation       1139
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204057374"
     variation       1140
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:939910500"
     variation       1141
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430202718"
     variation       1147
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1189195683"
     variation       1152
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1476969635"
     variation       1154
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1253133686"
     variation       1156
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:547647558"
     variation       1159
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442618813"
     variation       1164
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777053562"
     variation       1166
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020575139"
     variation       1167
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270684352"
     variation       1169
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1036978695"
     exon            1172..1269
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       1177
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406016719"
     variation       1187
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:920346685"
     variation       1193
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868364617"
     variation       1194
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1450856110"
     variation       1196
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281359717"
     variation       1209
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781292950"
     variation       1211
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1380409339"
     variation       1213
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348916333"
     variation       1214
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1390446648"
     variation       1221
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1297179280"
     variation       1223
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304503223"
     variation       1226
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1035419180"
     variation       1232
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1330522085"
     variation       1236
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1228486102"
     variation       1237
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1262380334"
     variation       1240
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1235179501"
     variation       1242
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568469465"
     variation       1246
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951385853"
     variation       1254..1257
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1568469475"
     variation       1257
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1205530622"
     variation       1260
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1237817867"
     variation       1261
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480222517"
     variation       1266
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1468869057"
     exon            1270..1346
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       1270
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769384800"
     variation       1271
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549119218"
     variation       1273
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753384518"
     variation       1283
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599566124"
     variation       1289
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426557365"
     variation       1291
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409727489"
     variation       1302
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1280524433"
     variation       1304
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238547340"
     variation       1307
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1168826651"
     variation       1308
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1334171759"
     variation       1309..1311
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="ata"
                     /replace="atata"
                     /db_xref="dbSNP:774468097"
     variation       1309
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1568469827"
     variation       1310
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1372828196"
     variation       1313
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1429936448"
     variation       1316
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1302158250"
     variation       1327
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256257980"
     variation       1332
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1044292222"
     variation       1342
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116659996"
     variation       1343
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1162590115"
     exon            1347..1427
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       1349
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333165628"
     variation       1351
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780179373"
     variation       1352
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747103273"
     variation       1355
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758434492"
     variation       1357
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896277892"
     variation       1359
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1354559274"
     variation       1362
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230270287"
     variation       1371
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947685617"
     variation       1373
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572470856"
     variation       1376..1379
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1293504372"
     variation       1377
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:887746660"
     variation       1381
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045159218"
     variation       1385..1391
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="tga"
                     /replace="tgactga"
                     /db_xref="dbSNP:1482633892"
     variation       1389
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250513245"
     variation       1392
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1599571178"
     variation       1399
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1465616535"
     variation       1400
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183413203"
     variation       1403
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1007827990"
     variation       1408
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768528554"
     variation       1409..1415
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="agaa"
                     /replace="agaagaa"
                     /db_xref="dbSNP:1568471894"
     variation       1411
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473549598"
     variation       1413
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776055194"
     variation       1415
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599571229"
     variation       1419
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163498215"
     variation       1421
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406525611"
     variation       1423
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1398520077"
     variation       1426
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:777981761"
     exon            1428..1488
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       1429
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1183765250"
     variation       1447
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867877686"
     variation       1449
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412106076"
     variation       1454
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1469184186"
     variation       1457
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770224989"
     variation       1459
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1404001992"
     variation       1460
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:528655910"
     variation       1461
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:551696843"
     variation       1462
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768268292"
     variation       1463
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1022950129"
     variation       1465
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215022142"
     variation       1467
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:571868280"
     variation       1468
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1290242641"
     variation       1471
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:981699839"
     variation       1473
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599589729"
     variation       1474
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1351202131"
     variation       1476
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223362423"
     variation       1479..1482
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="tctc"
                     /replace="tctctc"
                     /db_xref="dbSNP:1254832395"
     variation       1481
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767957315"
     variation       1483
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201437907"
     variation       1484
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1271814701"
     variation       1485
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1026516551"
     variation       1486
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1183926304"
     exon            1489..1623
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /inference="alignment:Splign:2.1.0"
     variation       1498
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1274988634"
     variation       1515
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1388655997"
     variation       1516
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1490038961"
     variation       1517
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:974883416"
     variation       1519..1523
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1207600561"
     variation       1520
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391955756"
     variation       1523
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4805011"
     variation       1526
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1465755237"
     variation       1528
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1422484063"
     variation       1530
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:932968079"
     variation       1531
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1452066002"
     variation       1532
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1192404103"
     variation       1533
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1434466720"
     variation       1537
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1388022726"
     variation       1538
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1451174123"
     variation       1547
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765856492"
     variation       1551
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1042361093"
     variation       1552
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:902437466"
     variation       1553
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:936545843"
     variation       1556
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374571113"
     variation       1557
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769248097"
     variation       1562
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1199679601"
     variation       1582..1586
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="tgttc"
                     /replace="tgttctgttc"
                     /db_xref="dbSNP:1568480155"
     variation       1586..1587
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1414195257"
     variation       1603
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:893366795"
     variation       1607
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775863310"
     variation       1608
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:528790367"
     variation       1619
                     /gene="TDRD12"
                     /gene_synonym="ECAT8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300709190"
ORIGIN      
ctgctcagcgtgcgcgggcatccggtgggtgcgggaggcccgaggccaggcaggcagggatcccgcagcgaggggctggttactgccaggacggagcgcattgcctcgagccgaccccggggtccgcgagggctcctggggacgaggagtgtggggcacctgccgcggggggcccaggcgctaaaggtggagggaaggaacgcactcgcggcgggggcctggccggggcggacgcagccagcctcacccgcgacggtaggggacttccagggcgagggggcccatctgccctcgggcgccaggaggatgctccagctcctggtgctgaagattgaagatccaggttgcttctgggttattataaaagggtgtagtccctttttagatcatgatgtcgattatcaaaaattaaatagtgccatgaatgacttctacaacagcacgtgtcaagatatagaaataaaacccttaacattggaagaaggacaggtgtgtgtggtctattgtgaggagctaaagtgctggtgcagggccattgtcaaatcaattacgtcttccgcagaccagtacctggcagaatgtttccttgtggactttgccaagaacattccagtcaaatctaaaaacatccgagttgtagtagaatcgtttatgcagcttccctatagagcaaaaaaattcagcctgtactgcacaaagcctgtcacattacacattgacttctgccgagacagtactgacattgtacctgccaagaagtgggacaatgcagctattcagtactttcagaaccttctgaaagcaactacccaggtggaagccagattatgtgctgtggaagaagatacatttgaggtttacctttatgtaactataaaagatgaaaaagtttgtgttaatgatgatcttgttgcaaagaactatgcttgttatatgtcacctacaaagaataaaaaccttgattatttagaaaaaccaagattgaatataaaatcagcaccctccttcaataaactcaatccagcacttacactctggccaatgtttttgcaaggaaaagatgttcaaggaatggaagattcacatggtgtaaattttccggcacaatctctgcaacatacatggtgcaagggtattgtcggtgacctcaggccaacagccacagcacaggacaaagctgtaaaatgtaatatggattcattgagagattcacctaaagacaaatctgaaaagaaacaccattgcatctctttaaaagatacaaataagcgtgttgaatcctcagtgtactggccagcaaaaagaggcataaccatatatgctgatccagatgtaccagaagcaagtgctttaagtcagaagtcaaatgagaaacctcttagattgactgagaagaaagaatatgatgagaagaatagctgtgtgaaattactgcagtttttaaatcctgatcctttgagagctgacggaatctctgatctccagcagacttgagattagaagagaaactccttagatgggggacttaacctgaagacatccttttagaaacgatcgaatggattgttgcttctgagaaattgttccttgttttttggataataaacgatcttccttttggta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]