GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-19 07:09:01, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001110144             663 bp    mRNA    linear   ROD 02-APR-2025
DEFINITION  Rattus norvegicus claudin 24 (Cldn24), mRNA.
ACCESSION   NM_001110144 XM_001059310 XM_577519
VERSION     NM_001110144.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 663)
  AUTHORS   Mineta,K., Yamamoto,Y., Yamazaki,Y., Tanaka,H., Tada,Y., Saito,K.,
            Tamura,A., Igarashi,M., Endo,T., Takeuchi,K. and Tsukita,S.
  TITLE     Predicted expansion of the claudin multigene family
  JOURNAL   FEBS Lett 585 (4), 606-612 (2011)
   PUBMED   21276448
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473995.2.
            
            On or before Oct 26, 2007 this sequence version replaced
            XM_577519.1, XM_001059310.1.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="16"
                     /map="16q11"
     gene            1..663
                     /gene="Cldn24"
                     /gene_synonym="RGD1562043"
                     /note="claudin 24"
                     /db_xref="GeneID:502083"
                     /db_xref="RGD:1562043"
     CDS             1..663
                     /gene="Cldn24"
                     /gene_synonym="RGD1562043"
                     /note="claudin 22 like"
                     /codon_start=1
                     /product="putative claudin-24"
                     /protein_id="NP_001103614.1"
                     /db_xref="GeneID:502083"
                     /db_xref="RGD:1562043"
                     /translation="
MAFIFKTAMQSVALSLSLLGWVLAITTTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGLCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHSSYLENGTAQPKV"
     misc_feature    19..540
                     /gene="Cldn24"
                     /gene_synonym="RGD1562043"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            1..663
                     /gene="Cldn24"
                     /gene_synonym="RGD1562043"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggctttcatcttcaaaacggccatgcaatcggtcgcgctttctctgtcattgctgggatgggttctagccattactaccacgtatctgccacactggaagaacctcaacctggagctgaacgagatggaaaactggaccatggggctctggaaatcctgcgtcatccaggaggaggtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcagatctccaggatcctgatgtccctgtccaatgggctggggctgctgggcttgctggcctctggctgtggcctggactgtctgaggctcggagagacccggaagggtctgaagaggcgactgctcatcctgggagggaccctgctctggacctctggtgtgatggtcctggttcctgtctcctgggtggcccacatgacagtgcaagagttctgggatgagactgtacctgagattgtgcccaggtgggagttcggggaggccctgttcctgggctggtttgctggtctctgcctggtgcttggaggatgtgtgcttcactgtgcagcctgctggaggccggctcctccagcctcgggccactatgcagtggcgggacttggagaccacagttcatacctggaaaatggaactgcacagcctaaagtgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]