GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 14:40:10, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001110143            1010 bp    mRNA    linear   ROD 25-AUG-2016
DEFINITION  Rattus norvegicus claudin 22 (Cldn22), mRNA.
ACCESSION   NM_001110143 XM_001059255 XM_224843
VERSION     NM_001110143.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1010)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim. Biophys. Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473995.2.
            On or before Oct 26, 2007 this sequence version replaced
            XM_224843.2, XM_001059255.1.
FEATURES             Location/Qualifiers
     source          1..1010
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="16"
                     /map="16q11"
     gene            1..1010
                     /gene="Cldn22"
                     /note="claudin 22"
                     /db_xref="GeneID:306454"
                     /db_xref="RGD:1305271"
     CDS             48..710
                     /gene="Cldn22"
                     /codon_start=1
                     /product="claudin-22"
                     /protein_id="NP_001103613.1"
                     /db_xref="GeneID:306454"
                     /db_xref="RGD:1305271"
                     /translation="
MGLVFRTATQSAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHQQHLELKQANPEV"
     misc_feature    <192..596
                     /gene="Cldn22"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     STS             817..1000
                     /gene="Cldn22"
                     /standard_name="RH138522"
                     /db_xref="UniSTS:220609"
ORIGIN      
aagcgtggggcaggagttgggctggctcaggctcacagaacgttctaatgggcttagtcttccgaacggcaactcagtcagctgcactcctgctctctctgctgggatgggttttatcctgcctcacaaactacttgccacactggaagaacctcaacctggagctgaacgagatggaaaactggactatggggctctggaaatcctgcgtcatccaggaggaggtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcagatctccaggatcctgatgtccctgtccaatgggctggggctgctgggcttgctggcctctggctgtggcctggactgtctgaggctcggagagacccggaagggtctgaagaggcgactgctcatcctgggagggaccctgctctggacctctggtgtgatggtcctggttcctgtctcctgggtggcccacatgacagtgcaagagttctgggatgagactgtacctgagattgtgcccaggtgggagttcggggaggccctgttcctgggctggtttgctggtttctgcctggtgcttggaggatgtgtgcttcactgtgcagcctgctggaggccggctcctccagcctcgggccactatgcagtggcgggactaggagaccaccagcagcatctggagctgaaacaagctaacccagaagtctaagcccgagggatcagtggcatctctgatctcactcagctggacttggtaggctctcctgctataatcacccctactcactgtgcttttgatttctctgaaatgcatacttccctcctgtggctatcatcctcttcaaatacaagttctctctacaaccgggtaaagagcttctacttcctattcggaggccaagtgagtcaggacctatggatggagtctgtcgctactgggcagaagctctgcctcccttttaaagcagactgtgacacagggcaccagtaaataaagcattatctgagc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]