ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-28 16:28:13, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001109884 2068 bp mRNA linear ROD 27-JUN-2025
DEFINITION Rattus norvegicus homeo box C4 (Hoxc4), mRNA.
ACCESSION NM_001109884 XM_235703
VERSION NM_001109884.1
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 2068)
AUTHORS Schmidt,J.A., Avarbock,M.R., Tobias,J.W. and Brinster,R.L.
TITLE Identification of glial cell line-derived neurotrophic
factor-regulated genes important for spermatogonial stem cell
self-renewal in the rat
JOURNAL Biol Reprod 81 (1), 56-66 (2009)
PUBMED 19339709
REFERENCE 2 (bases 1 to 2068)
AUTHORS Calonge,W.M., Martinez,L., Lacadena,J., Fernandez-Dumont,V.,
Matesanz,R. and Tovar,J.A.
TITLE Expression of homeotic genes Hoxa3, Hoxb3, Hoxd3 and Hoxc4 is
decreased in the lungs but not in the hearts of adriamycin-exposed
mice
JOURNAL Pediatr Surg Int 23 (5), 419-424 (2007)
PUBMED 17211587
REFERENCE 3 (bases 1 to 2068)
AUTHORS Wissmuller,S., Kosian,T., Wolf,M., Finzsch,M. and Wegner,M.
TITLE The high-mobility-group domain of Sox proteins interacts with
DNA-binding domains of many transcription factors
JOURNAL Nucleic Acids Res 34 (6), 1735-1744 (2006)
PUBMED 16582099
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 2068)
AUTHORS Kim,E.C., Edmonston,C.R., Wu,X., Schaffer,A. and Casali,P.
TITLE The HoxC4 homeodomain protein mediates activation of the
immunoglobulin heavy chain 3' hs1,2 enhancer in human B cells.
Relevance to class switch DNA recombination
JOURNAL J Biol Chem 279 (40), 42258-42269 (2004)
PUBMED 15252056
REFERENCE 5 (bases 1 to 2068)
AUTHORS Boulet,A.M. and Capecchi,M.R.
TITLE Targeted disruption of hoxc-4 causes esophageal defects and
vertebral transformations
JOURNAL Dev Biol 177 (1), 232-249 (1996)
PUBMED 8660891
REFERENCE 6 (bases 1 to 2068)
AUTHORS Saegusa,H., Takahashi,N., Noguchi,S. and Suemori,H.
TITLE Targeted disruption in the mouse Hoxc-4 locus results in axial
skeleton homeosis and malformation of the xiphoid process
JOURNAL Dev Biol 174 (1), 55-64 (1996)
PUBMED 8626021
REFERENCE 7 (bases 1 to 2068)
AUTHORS Chung,S.Y., Dai,P.H., Lei,J., Riviere,M., Levan,G., Szpirer,J. and
Szpirer,C.
TITLE Chromosomal assignment of seven rat homeobox genes to rat
chromosomes 3, 4, 7, and 10
JOURNAL Mamm Genome 4 (9), 537-540 (1993)
PUBMED 7906969
REFERENCE 8 (bases 1 to 2068)
AUTHORS Falzon,M. and Chung,S.Y.
TITLE The expression of rat homeobox-containing genes is developmentally
regulated and tissue specific
JOURNAL Development 103 (3), 601-610 (1988)
PUBMED 2907739
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from
JAXUCZ010000007.1.
On Oct 10, 2007 this sequence version replaced XM_235703.3.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
##Evidence-Data-START##
Transcript exon combination :: SRR26643288.32650.1, FN802484.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA5760434, SAMN06621351
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-866 JAXUCZ010000007.1 136049059-136049924
867-2068 JAXUCZ010000007.1 136050400-136051601
FEATURES Location/Qualifiers
source 1..2068
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN"
/db_xref="taxon:10116"
/chromosome="7"
/map="7q36"
gene 1..2068
/gene="Hoxc4"
/gene_synonym="Hox3r3"
/note="homeo box C4"
/db_xref="GeneID:24459"
/db_xref="RGD:1586210"
exon 1..866
/gene="Hoxc4"
/gene_synonym="Hox3r3"
/inference="alignment:Splign:2.1.0"
misc_feature 356..358
/gene="Hoxc4"
/gene_synonym="Hox3r3"
/note="upstream in-frame stop codon"
CDS 428..1222
/gene="Hoxc4"
/gene_synonym="Hox3r3"
/note="homeobox protein R3; Homeobox gene C4"
/codon_start=1
/product="homeobox protein Hox-C4"
/protein_id="NP_001103354.1"
/db_xref="GeneID:24459"
/db_xref="RGD:1586210"
/translation="
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRAHGPAQAGHHHPEKSQPLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL"
misc_feature 896..1066
/gene="Hoxc4"
/gene_synonym="Hox3r3"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 867..2068
/gene="Hoxc4"
/gene_synonym="Hox3r3"
/inference="alignment:Splign:2.1.0"
ORIGIN
tggaaaggcactggagccgaggcccaccgggtccactgaaggccggagaggagactctgggtgggggctgaatcacagcctaccaacagcccccaatgcccagacattggagtcgagctgggagccacccatcttctgcaagggaggattgtcagtctggtggggtgtgcaatggtgagcaccccagcttctgccagccatccccccaccccaccccctcagcagcagcagcaccacacacacaaaaaattggatacattttgaataaagcgattcggttccttatccggggactgagttgctcggtgtgattggccggcggagtcacatggtgaaagtaactttacagggtcgctagctagtaggagggctttatggagcagaaaaacgacaaagcgagaaaaattattttccactccagaaattaatgatcatgagctcgtatttgatggactctaactacatcgatccgaaatttcctccatgcgaagaatattcgcaaaatagctacatccctgaacacagtccggaatattacggccggaccagggaatcgggattccagcatcaccaccaggagctgtacccaccaccgcctccgcgccctagctaccctgagcgtcagtatagctgcaccagtctccaggggcccggcaattcgcgagcccacgggccggcccaggcgggccaccaccaccctgagaaatcgcagccgctctgcgagccggcgcctctctcaggcgcctctgcctccccgtccccagccccgccagcctgcagccagccagcccctgaccatccctccagcgccgccagcaagcagcccatagtctacccttggatgaaaaaaattcacgttagcacggtgaaccccaattataacggaggggagcccaagcgctcgaggacagcctacacccggcagcaggtcctggaattagagaaagagtttcattacaaccgctacctgacccgaaggagaaggatcgagatcgcccactcgctgtgcctctctgagaggcagatcaaaatctggttccaaaaccgtcgcatgaaatggaagaaggaccaccgactccccaacaccaaagtgaggtcagcgcccccggccggcgctgcacccagcaccctctcggcagccacccccggcacttctgaagaccactcccagagcgccacgccgccggagcagcaacgggcagaggacatcaccaggttataagacataacttacacccctgcccccaccctgtgctccgtgccccctcacacacaaattgactcttatttatagaatttaatatatatatatttttggttctttttttctctctcttcctcctgtctcctcccttgtcagttccaaacagacaaaacagataaacaaacaagccccttgcccttttccctttgctgttaaggacccctttaagcatgtggtgttgtcttagcatggtacctgctgggttttattttttgttgttttgttttgttttgctttgctttgcttttaaggccattggggggtatttattttttaaggaaaaaaagctgcaaaaattatatattgcaaggtgtgatggtctggtttgggtgaatttcaggggaaatgaggaacagaaaaaggaaagggagatttgtaagtggattctcatcctctctcctcctcaccccccctccctttccttaggccttttgcattgaaaatgcaccaggggaggttagtgaggggggggagtcattttaaggagaacaaagctatgaagttcttttgtattcttgtgggggggtggtaggaggggggaggacagcaaacaaagctaaatgcatctggagagcctctgggagctgttcagtttgaggagccaaaaaataaataaataaataaaaatgaactttcagttcagagaggcagtctataggtagatgctcccctacccccatcgtggttattgtgtttttggactgaatttacttgattattgtaaaacttgcaataaagaattttagtgttgatgtgaaatgcccccgtgatcaataataaaccagtggctgtgaattagtttta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]