GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-26 23:52:30, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001109809            2082 bp    mRNA    linear   PRI 30-AUG-2020
DEFINITION  Homo sapiens ZFP57 zinc finger protein (ZFP57), transcript variant
            1, mRNA.
ACCESSION   NM_001109809 XM_011514570 XM_294093 XM_936098 XM_936136 XM_940744
VERSION     NM_001109809.5
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2082)
  AUTHORS   Shoji Y, Takamura H, Ninomiya I, Fushida S, Tada Y, Yokota T, Ohta
            T and Koide H.
  TITLE     The Embryonic Stem Cell-Specific Transcription Factor ZFP57
            Promotes Liver Metastasis of Colorectal Cancer
  JOURNAL   J. Surg. Res. 237, 22-29 (2019)
   PUBMED   30694787
  REMARK    GeneRIF: Study demonstrated that ZFP57 plays an important role in
            the hematogenous metastasis of colorectal cancer, suggesting that
            it could be used as a novel treatment target. The expression level
            of ZFP57 was significantly correlated with that of the
            metastasis-related gene NANOG and ZFP57 overexpression reduced the
            progression-free survival rate of patients with colorectal cancer.
REFERENCE   2  (bases 1 to 2082)
  AUTHORS   Chen L, Wu X, Xie H, Yao N, Xia Y, Ma G, Qian M, Ge H, Cui Y, Huang
            Y, Wang S and Zheng M.
  TITLE     ZFP57 suppress proliferation of breast cancer cells through
            down-regulation of MEST-mediated Wnt/beta-catenin signalling
            pathway
  JOURNAL   Cell Death Dis 10 (3), 169 (2019)
   PUBMED   30787268
  REMARK    GeneRIF: ZFP57-MEST and the Wnt/beta-catenin pathway axis are
            involved in breast tumorigenesis, which may represent a potential
            diagnostic biomarker, and provide a new insight into a novel
            therapeutic strategy for breast cancer patients.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2082)
  AUTHORS   Takahashi N, Coluccio A, Thorball CW, Planet E, Shi H, Offner S,
            Turelli P, Imbeault M, Ferguson-Smith AC and Trono D.
  TITLE     ZNF445 is a primary regulator of genomic imprinting
  JOURNAL   Genes Dev. 33 (1-2), 49-54 (2019)
   PUBMED   30602440
REFERENCE   4  (bases 1 to 2082)
  AUTHORS   Sparago A, Cerrato F and Riccio A.
  TITLE     Is ZFP57 binding to H19/IGF2:IG-DMR affected in Silver-Russell
            syndrome?
  JOURNAL   Clin Epigenetics 10, 23 (2018)
   PUBMED   29484033
  REMARK    GeneRIF: Data propose that paternal deletions are associated with
            Silver-Russell syndrome when ZFP57 binding is affected and this
            happens when one of the three ZFP57 binding regions to H19/IGF2
            intergenic differentially methylated region is lost.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2082)
  AUTHORS   Bak M, Boonen SE, Dahl C, Hahnemann JM, Mackay DJ, Tumer Z,
            Gronskov K, Temple IK, Guldberg P and Tommerup N.
  TITLE     Genome-wide DNA methylation analysis of transient neonatal diabetes
            type 1 patients with mutations in ZFP57
  JOURNAL   BMC Med. Genet. 17, 29 (2016)
   PUBMED   27075368
  REMARK    GeneRIF: transient neonatal diabetes type 1 is associated with
            ZFP57 mutations
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2082)
  AUTHORS   Li X, Ito M, Zhou F, Youngson N, Zuo X, Leder P and Ferguson-Smith
            AC.
  TITLE     A maternal-zygotic effect gene, Zfp57, maintains both maternal and
            paternal imprints
  JOURNAL   Dev. Cell 15 (4), 547-557 (2008)
   PUBMED   18854139
REFERENCE   7  (bases 1 to 2082)
  AUTHORS   Mackay DJ, Callaway JL, Marks SM, White HE, Acerini CL, Boonen SE,
            Dayanikli P, Firth HV, Goodship JA, Haemers AP, Hahnemann JM,
            Kordonouri O, Masoud AF, Oestergaard E, Storr J, Ellard S,
            Hattersley AT, Robinson DO and Temple IK.
  TITLE     Hypomethylation of multiple imprinted loci in individuals with
            transient neonatal diabetes is associated with mutations in ZFP57
  JOURNAL   Nat. Genet. 40 (8), 949-951 (2008)
   PUBMED   18622393
  REMARK    GeneRIF: Study reports mutations in ZFP57, which encodes a
            zinc-finger transcription factor expressed in early development, in
            seven pedigrees with a shared pattern of mosaic hypomethylation and
            a conserved range of clinical features.
REFERENCE   8  (bases 1 to 2082)
  AUTHORS   Alonso MB, Zoidl G, Taveggia C, Bosse F, Zoidl C, Rahman M,
            Parmantier E, Dean CH, Harris BS, Wrabetz L, Muller HW, Jessen KR
            and Mirsky R.
  TITLE     Identification and characterization of ZFP-57, a novel zinc finger
            transcription factor in the mammalian peripheral nervous system
  JOURNAL   J. Biol. Chem. 279 (24), 25653-25664 (2004)
   PUBMED   15070898
REFERENCE   9  (bases 1 to 2082)
  AUTHORS   Okazaki S, Tanase S, Choudhury BK, Setoyama K, Miura R, Ogawa M and
            Setoyama C.
  TITLE     A novel nuclear protein with zinc fingers down-regulated during
            early mammalian cell differentiation
  JOURNAL   J. Biol. Chem. 269 (9), 6900-6907 (1994)
   PUBMED   8120052
REFERENCE   10 (bases 1 to 2082)
  AUTHORS   Temple,I.K. and Mackay,D.J.G.
  TITLE     Diabetes Mellitus, 6q24-Related Transient Neonatal
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301706
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL645936.5.
            On Feb 3, 2020 this sequence version replaced NM_001109809.4.
            
            Summary: The protein encoded by this gene is a zinc finger protein
            containing a KRAB domain. Studies in mouse suggest that this
            protein may function as a transcriptional repressor. Mutations in
            this gene have been associated with transient neonatal diabetes
            mellitus type 1 (TNDM1).[provided by RefSeq, Sep 2009].
            
            Transcript Variant: This variant (1) represents the longer
            transcript and encodes the longer isoform (1).
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            CDS exon combination :: BC157878.1 [ECO:0000331]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000376883.2/ ENSP00000366080.2
            RefSeq Select criteria :: based on manual assertion, conservation,
                                      expression, longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-91                AL645936.5         132048-132138       c
            92-577              AL645936.5         127867-128352       c
            578-704             AL645936.5         126919-127045       c
            705-806             AL645936.5         126372-126473       c
            807-2082            AL645936.5         123469-124744       c
FEATURES             Location/Qualifiers
     source          1..2082
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p22.1"
     gene            1..2082
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="ZFP57 zinc finger protein"
                     /db_xref="GeneID:346171"
                     /db_xref="HGNC:HGNC:18791"
                     /db_xref="MIM:612192"
     exon            1..91
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       4
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:900415574"
     variation       7
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1395846905"
     variation       11
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377436452"
     variation       14
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944526204"
     variation       19
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237975289"
     variation       20
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1308631301"
     variation       23
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:911741546"
     variation       24
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312915772"
     variation       25
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1042096521"
     variation       28
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1254527315"
     variation       29
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:945130687"
     variation       35
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2747432"
     variation       38
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202823192"
     variation       43
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978493866"
     variation       44
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968425423"
     variation       45
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:989096420"
     variation       46
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237022199"
     variation       47
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:959068610"
     variation       54
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433310222"
     variation       55
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1177745924"
     variation       56
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375600987"
     variation       72
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1465810702"
     variation       80
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:927515715"
     variation       82
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1403000827"
     variation       83
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363983965"
     variation       85
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:538637425"
     variation       90
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1010400183"
     exon            92..577
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       110
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1453229476"
     variation       111
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:940208454"
     variation       117
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2747421"
     variation       118
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748952495"
     variation       130
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1583181410"
     variation       134
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984623078"
     variation       143
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1410451600"
     variation       160
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:552472247"
     variation       162
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371727322"
     misc_feature    167..169
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="upstream in-frame stop codon"
     variation       172
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448571045"
     variation       177
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164186222"
     variation       179
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1253694588"
     variation       180
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1416474877"
     variation       187
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1404065501"
     variation       193
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1583181344"
     variation       196
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:563829445"
     variation       197
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2535238"
     variation       198
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:921646303"
     variation       199
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965257291"
     variation       203
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1053845322"
     variation       214
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1245857997"
     variation       230
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:528662406"
     variation       233
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1358238561"
     variation       235
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:62392952"
     variation       238
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1583181283"
     variation       256
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1317233026"
     variation       257
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1226485759"
     variation       258
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1285991631"
     variation       259
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1217099311"
     variation       261
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1346587774"
     variation       264
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200774997"
     variation       265
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55693745"
     variation       270
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363668690"
     variation       278
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:968970287"
     variation       283
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:977836299"
     variation       292
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:949535221"
     variation       294
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1431935361"
     variation       303
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1245731147"
     variation       305
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:561665912"
     variation       320
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:918068438"
     variation       323
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1347316180"
     variation       324
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:542080472"
     variation       326
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1332513593"
     variation       330
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1434320719"
     variation       332
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:576238179"
     variation       335
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1413354854"
     variation       352
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1459334818"
     variation       354
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562227510"
     variation       365
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56225127"
     variation       374
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1396781437"
     variation       376
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1336424772"
     variation       377
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401422166"
     variation       378
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341980422"
     variation       380
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:545673761"
     variation       383
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:894108102"
     variation       389
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1027013219"
     variation       407
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329761489"
     variation       413
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1200014655"
     variation       415
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745971548"
     variation       417
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230204129"
     variation       420
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:577462876"
     variation       425
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757331612"
     variation       438..441
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ac"
                     /replace="acac"
                     /db_xref="dbSNP:757143658"
     variation       449..451
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="gag"
                     /db_xref="dbSNP:746785399"
     variation       451
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752060415"
     variation       452
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778281905"
     CDS             455..2065
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="isoform 1 is encoded by transcript variant 1; zinc
                     finger protein 57 homolog; zfp-57; zinc finger protein
                     698"
                     /codon_start=1
                     /product="zinc finger protein 57 homolog isoform 1"
                     /protein_id="NP_001103279.2"
                     /db_xref="CCDS:CCDS43436.2"
                     /db_xref="GeneID:346171"
                     /db_xref="HGNC:HGNC:18791"
                     /db_xref="MIM:612192"
                     /translation="
MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK"
     misc_feature    584..766
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="krueppel associated box; Region: KRAB; smart00349"
                     /db_xref="CDD:214630"
     misc_feature    983..1045
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(983..985,992..994,1031..1033,1043..1045)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    <1007..1744
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="FOG: Zn-finger [General function prediction only];
                     Region: COG5048"
                     /db_xref="CDD:227381"
     misc_feature    1067..1129
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1067..1069,1076..1078,1115..1117,1127..1129)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(1082..1084,1088..1090,1094..1096,1100..1105,
                     1112..1117,1124..1126,1166..1168,1172..1174,1184..1189,
                     1196..1201,1208..1210,1250..1252,1256..1258,1262..1264,
                     1268..1273,1280..1285,1292..1294)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1151..1213
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1151..1153,1160..1162,1199..1201,1211..1213)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1235..1297
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1235..1237,1244..1246,1283..1285,1295..1297)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1610..1672
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1610..1612,1619..1621,1658..1660,1670..1672)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(1625..1627,1631..1633,1637..1639,1643..1648,
                     1655..1660,1667..1669,1709..1711,1715..1717,1727..1732,
                     1739..1744,1751..1753,1793..1795,1799..1801,1805..1807,
                     1811..1816,1823..1828)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1694..1756
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1694..1696,1703..1705,1742..1744,1754..1756)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1778..1834
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     variation       461
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1228040568"
     variation       466
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1378332025"
     variation       469
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1312038470"
     variation       470
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1445188572"
     variation       472
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1399694782"
     variation       476
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554258741"
     variation       478
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:534190757"
     variation       479
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764891362"
     variation       481
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:759235269"
     variation       486
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1443735919"
     variation       488
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753497424"
     variation       495
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765871300"
     variation       496
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437747425"
     variation       501
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562227353"
     variation       502
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760220762"
     variation       510
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371500990"
     variation       511
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772067986"
     variation       512
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761732364"
     variation       514
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1008241150"
     variation       521
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354933705"
     variation       522
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774242257"
     variation       525
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768553621"
     variation       526
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746135187"
     variation       529
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:777488576"
     variation       529
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776910241"
     variation       530
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:890299103"
     variation       537
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1388520831"
     variation       538
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1365790127"
     variation       550
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770926371"
     variation       552
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420512368"
     variation       559
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139717984"
     variation       560
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1174465234"
     variation       561
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1400331837"
     variation       566
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114772002"
     variation       567..569
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:758356804"
     variation       567
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142917604"
     variation       569
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1411544905"
     variation       574
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363095080"
     variation       577
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758850767"
     exon            578..704
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       582
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574707884"
     variation       583
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374295115"
     variation       586
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371178364"
     variation       591
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562226131"
     variation       602
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202743486"
     variation       604
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1482556690"
     variation       610
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377042735"
     variation       617
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305176738"
     variation       636
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773388964"
     variation       637
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375456558"
     variation       639
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:748718399"
     variation       644
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218225400"
     variation       645
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1325682251"
     variation       646
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779376984"
     variation       652
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1234019681"
     variation       660
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755350593"
     variation       662
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1275852223"
     variation       663
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:191653089"
     variation       672
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749602208"
     variation       675
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186800938"
     variation       676..683
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="ggaaacct"
                     /db_xref="dbSNP:776117155"
     variation       676
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546769900"
     variation       681..682
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1583179644"
     variation       681
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458704903"
     variation       687..699
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="agaatctaacatc"
                     /db_xref="dbSNP:770056554"
     variation       691
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:750025018"
     variation       700
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1562225992"
     variation       701
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474857805"
     exon            705..806
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       713
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774843855"
     variation       715
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346592440"
     variation       720
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444492534"
     variation       725
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1384983515"
     variation       727
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373052417"
     variation       729
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442084428"
     variation       731
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369213004"
     variation       734
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780517451"
     variation       736
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377556293"
     variation       739
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373253380"
     variation       742
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745602868"
     variation       743
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369717350"
     variation       753..754
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:776707255"
     variation       756
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756845030"
     variation       766..772
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="gag"
                     /replace="gagag"
                     /replace="gagagag"
                     /db_xref="dbSNP:606231121"
     variation       769
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:751070267"
     variation       772
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249349485"
     variation       773
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777872562"
     variation       774
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1277272289"
     variation       775
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758407681"
     variation       776
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1331351012"
     variation       787
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752544644"
     variation       791
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765144886"
     variation       801..803
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1229065582"
     exon            807..2082
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       811
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1276106077"
     variation       818
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1221373524"
     variation       825..826
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1344415728"
     variation       828
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:114591600"
     variation       838
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:971469760"
     variation       839
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746634665"
     variation       841
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374760825"
     variation       847..852
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="gaga"
                     /replace="gagaga"
                     /db_xref="dbSNP:747207653"
     variation       853
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:922250508"
     variation       854
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1241267382"
     variation       855
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:777578657"
     variation       855
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1318298375"
     variation       859
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319542001"
     variation       861
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757840663"
     variation       863
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752735462"
     variation       867
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480239392"
     variation       868
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1196716120"
     variation       879
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424559396"
     variation       880
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194148394"
     variation       882
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1277703799"
     variation       884
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778657283"
     variation       886
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1247295402"
     variation       888
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:964122823"
     variation       893
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983459674"
     variation       895
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754805449"
     variation       896
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354005915"
     variation       898
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767749722"
     variation       899
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280148044"
     variation       902
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762074022"
     variation       903
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1190848529"
     variation       904
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1322433624"
     variation       907..911
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:771827176"
     variation       907
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1278377025"
     variation       909
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1220060178"
     variation       910
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751750269"
     variation       912
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:748137597"
     variation       913
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1027550840"
     variation       920
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1269974330"
     variation       928
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764303925"
     variation       929
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201703858"
     variation       930
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1334830817"
     variation       933
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1301617154"
     variation       937
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776081525"
     variation       938
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:968875761"
     variation       940
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765599364"
     variation       944
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759998407"
     variation       945
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200541066"
     variation       949
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771387494"
     variation       953
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185661286"
     variation       958
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746724268"
     variation       963
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239089042"
     variation       968
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772724131"
     variation       972
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:771624086"
     variation       976
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542920653"
     variation       977..983
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:1272756745"
     variation       977
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778941830"
     variation       979
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754861035"
     variation       981
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:749203567"
     variation       986
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146835830"
     variation       989
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001655263"
     variation       990
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1340163210"
     variation       997
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009205764"
     variation       1007
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755902229"
     variation       1009
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:563761778"
     variation       1013
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61730330"
     variation       1014
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452510913"
     variation       1017
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936245337"
     variation       1025
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764169187"
     variation       1026
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368581073"
     variation       1027
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1354091793"
     variation       1032
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1490718219"
     variation       1033
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374182967"
     variation       1034
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371536651"
     variation       1035
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760158033"
     variation       1045
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405687782"
     variation       1047
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9461544"
     variation       1048
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1422933793"
     variation       1056
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375036402"
     variation       1057
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761061868"
     variation       1058
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772922271"
     variation       1059
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771584295"
     variation       1065
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747717587"
     variation       1073
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370274313"
     variation       1075
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749291665"
     variation       1076
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:950226844"
     variation       1077
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323921002"
     variation       1087
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290038738"
     variation       1090
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779957149"
     variation       1091
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755918943"
     variation       1092
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917312314"
     variation       1097
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745587750"
     variation       1099
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1389706595"
     variation       1103
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778091529"
     variation       1106
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372896975"
     variation       1112
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294388360"
     variation       1113
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438833770"
     variation       1121
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758594645"
     variation       1122
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752929320"
     variation       1126
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1378857611"
     variation       1127
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237765445"
     variation       1133
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1583175309"
     variation       1140..1141
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1423947997"
     variation       1140
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983961658"
     variation       1141
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:574779981"
     variation       1149
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1040682124"
     variation       1155
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181230141"
     variation       1156
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211596222"
     variation       1158
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160694383"
     variation       1160
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755094030"
     variation       1161
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249176934"
     variation       1165
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754408148"
     variation       1168
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221844"
     variation       1170
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1489250818"
     variation       1175
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1253767105"
     variation       1177
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:387906227"
     variation       1178
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1554211826"
     variation       1186
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190197921"
     variation       1191
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1222131878"
     variation       1196
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488922640"
     variation       1197
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77625743"
     variation       1202
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750705477"
     variation       1203
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199589695"
     variation       1205
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761414885"
     variation       1206
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774050037"
     variation       1207
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768216433"
     variation       1208
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762393813"
     variation       1212
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173982165"
     variation       1215
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1358685458"
     variation       1216
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1404065735"
     variation       1218
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1361113486"
     variation       1222
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775414598"
     variation       1223
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1451540089"
     variation       1224..1225
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1562221637"
     variation       1224
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362771214"
     variation       1227
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769683397"
     variation       1233
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868001962"
     variation       1234
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481218759"
     variation       1235
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1426725604"
     variation       1237..1240
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1368158770"
     variation       1237
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61730328"
     variation       1239
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1488848205"
     variation       1242
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780884858"
     variation       1252
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886061285"
     variation       1258
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562221514"
     variation       1259
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770753045"
     variation       1260
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:796913217"
     variation       1265
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1485817791"
     variation       1273
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256677166"
     variation       1278
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1311114068"
     variation       1280
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:552912198"
     variation       1281
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748373430"
     variation       1283
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78378398"
     variation       1287
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780783557"
     variation       1288
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221400"
     variation       1292
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1219448045"
     variation       1293
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481245261"
     variation       1294
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1340970637"
     variation       1295
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198384465"
     variation       1297
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141297510"
     variation       1298
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1583174731"
     variation       1303
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1380473448"
     variation       1306
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:267600939"
     variation       1307
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745806203"
     variation       1311
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753928819"
     variation       1317
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:954556811"
     variation       1323
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020677270"
     variation       1324
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780728839"
     variation       1325
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200369502"
     variation       1330
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756629358"
     variation       1331
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750911552"
     variation       1333
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562221212"
     variation       1334
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221195"
     variation       1335
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:893438668"
     variation       1339
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1032415764"
     variation       1341
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1001893815"
     variation       1343
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970043595"
     variation       1346..1359
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ccaggc"
                     /replace="ccaggcacccaggc"
                     /db_xref="dbSNP:606231123"
     variation       1346
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1428444822"
     variation       1347
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767837891"
     variation       1350
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221096"
     variation       1351
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567544440"
     variation       1355
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1465324835"
     variation       1357
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1016766761"
     variation       1361
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1350262686"
     variation       1363
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369847099"
     variation       1366
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1446298140"
     variation       1368
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1291699041"
     variation       1369
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1366900421"
     variation       1373..1381
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="cc"
                     /replace="cccatcgcc"
                     /db_xref="dbSNP:778814024"
     variation       1373
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400043837"
     variation       1378
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262586492"
     variation       1379
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763672670"
     variation       1380
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778620158"
     variation       1382
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252862738"
     variation       1383
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224922089"
     variation       1390
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906101853"
     variation       1391
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61730327"
     variation       1392
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769259227"
     variation       1395
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759455258"
     variation       1397
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:994080864"
     variation       1399
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61730329"
     variation       1400
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776614741"
     variation       1404
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1335472515"
     variation       1405
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1465826374"
     variation       1409
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770642322"
     variation       1412
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1166547350"
     variation       1416
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746751205"
     variation       1417
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779308295"
     variation       1419
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166093143"
     variation       1423
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768950408"
     variation       1426
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1488932486"
     variation       1427
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749499233"
     variation       1430
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746760385"
     variation       1433
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1583174244"
     variation       1445
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368879630"
     variation       1448
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750951540"
     variation       1451
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:781684257"
     variation       1452
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889430650"
     variation       1459
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1292220386"
     variation       1463
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757570725"
     variation       1471
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751884998"
     variation       1475
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1406870266"
     variation       1477
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763762727"
     variation       1478
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446826654"
     variation       1480
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1337184269"
     variation       1482
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777685594"
     variation       1485
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758082902"
     variation       1487
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200537697"
     variation       1490
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:764708577"
     variation       1491
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165798284"
     variation       1495
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1299452041"
     variation       1499
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759027006"
     variation       1508
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385118076"
     variation       1514
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429251073"
     variation       1524
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1284420667"
     variation       1527
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776435097"
     variation       1538
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766297919"
     variation       1539
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1226944437"
     variation       1540
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61730326"
     variation       1548
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470651997"
     variation       1549
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1562220388"
     variation       1555
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202183128"
     variation       1556
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452388816"
     variation       1557
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2535241"
     variation       1561
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224349155"
     variation       1563
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185359504"
     variation       1565
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290881979"
     variation       1566
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:559348023"
     variation       1572
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:193232883"
     variation       1582
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745896871"
     variation       1588
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:987366144"
     variation       1590
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781584552"
     variation       1601
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529598384"
     variation       1602
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747496113"
     variation       1603
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184548139"
     variation       1606
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305373867"
     variation       1608
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1403442926"
     variation       1610
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1471959854"
     variation       1613
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144633545"
     variation       1615
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758744824"
     variation       1616
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402953555"
     variation       1617
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752357427"
     variation       1618
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764874679"
     variation       1621..1626
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="tt"
                     /replace="ttcttt"
                     /db_xref="dbSNP:754874675"
     variation       1621
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1583173719"
     variation       1635
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754475305"
     variation       1650
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:753338450"
     variation       1656
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:543657387"
     variation       1666
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267879910"
     variation       1668
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2535242"
     variation       1677
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420157851"
     variation       1680
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534295137"
     variation       1683
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773279387"
     variation       1684
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:578187010"
     variation       1688
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1334300140"
     variation       1694
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1360487434"
     variation       1696
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1445404101"
     variation       1705
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:958024543"
     variation       1708
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241317973"
     variation       1711
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761644594"
     variation       1713
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775582817"
     variation       1715
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:544556724"
     variation       1718
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221276996"
     variation       1730
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:745960774"
     variation       1732
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776825648"
     variation       1733
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747569394"
     variation       1734
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1343877566"
     variation       1736
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758763239"
     variation       1737
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:753298748"
     variation       1737
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1415060975"
     variation       1741
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748470752"
     variation       1744
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778450859"
     variation       1747
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1353665581"
     variation       1751
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754707433"
     variation       1756
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562219731"
     variation       1758
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1308237428"
     variation       1761
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753401097"
     variation       1766
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371992141"
     variation       1768
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755672721"
     variation       1774
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750984855"
     variation       1775
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:564988086"
     variation       1781
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209685547"
     variation       1783
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761734387"
     variation       1784
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1201455297"
     variation       1786
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:59871039"
     variation       1793
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751322940"
     variation       1794
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274151032"
     variation       1803
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763778116"
     variation       1812
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:759846876"
     variation       1813
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776700228"
     variation       1815
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771009420"
     variation       1817
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1378380148"
     variation       1824
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1469586178"
     variation       1826
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79020217"
     variation       1834
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368647820"
     variation       1837
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:606231122"
     variation       1840
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760678264"
     variation       1843
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773736935"
     variation       1844
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426675317"
     variation       1850
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1339349810"
     variation       1852
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335662355"
     variation       1858..1859
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:779565308"
     variation       1863
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993966100"
     variation       1870
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355295275"
     variation       1871
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772517149"
     variation       1880
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190525528"
     variation       1881
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779374306"
     variation       1882
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1167336463"
     variation       1883
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1276621351"
     variation       1889
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1342976931"
     variation       1895
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445158078"
     variation       1897
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1244454117"
     variation       1904
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181136742"
     variation       1906
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1019964083"
     variation       1909
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460618831"
     variation       1913
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768898589"
     variation       1915
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1206154386"
     variation       1917
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1023184421"
     variation       1919
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1272737158"
     variation       1922
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247421177"
     variation       1926
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184974475"
     variation       1929
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1313049165"
     variation       1931
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779516588"
     variation       1932
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379362378"
     variation       1934
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755691087"
     variation       1937
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300159881"
     variation       1939
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749915090"
     variation       1941
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188715625"
     variation       1952
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781303296"
     variation       1955
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:896106578"
     variation       1963
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757316381"
     variation       1965
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1048360904"
     variation       1967..1972
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:1562218802"
     variation       1968..1991
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="cccccagga"
                     /replace="cccccaggatccatacccccagga"
                     /db_xref="dbSNP:750068333"
     variation       1970
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764004089"
     variation       1971
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993701924"
     variation       1972
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754092341"
     variation       1973
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562218757"
     variation       1974
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147411133"
     variation       1977
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1422777845"
     variation       1983..1987
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:755751642"
     variation       1983
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773321909"
     variation       1984
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772117596"
     variation       1985
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762440334"
     variation       1986
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774715942"
     variation       1987
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769068037"
     variation       1989
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866369559"
     variation       1993
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:943349344"
     variation       1997
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1326093620"
     variation       1998
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749555948"
     variation       1999..2000
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:764601710"
     variation       1999
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:797046123"
     variation       2004
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775303301"
     variation       2007
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:769528747"
     variation       2012
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1222298541"
     variation       2013
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372785368"
     variation       2021
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745482780"
     variation       2026
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1405276138"
     variation       2034..2039
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="agg"
                     /replace="aggagg"
                     /db_xref="dbSNP:1345328002"
     variation       2034
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780894497"
     variation       2036
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:572960141"
     variation       2038
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1217039986"
     variation       2039
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:575606060"
     variation       2051
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542605540"
     variation       2057
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:913859647"
     variation       2058..2067
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ataaat"
                     /replace="ataaataaat"
                     /db_xref="dbSNP:1269341773"
     variation       2058
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79455213"
     variation       2059
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752397345"
     variation       2063
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1583172159"
     variation       2069
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764988283"
     variation       2071
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1199672355"
     variation       2073
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756378639"
ORIGIN      
gccgggactgcgggtgctcggccggagcgctccagccgctggtccccgggagaccctgtgcccctaaatcgcggtccactgcgcgcgtcaggtttctagaagcagggtagaacagacggcagacacctagcccaggctggtgttgttactaaacaatggcagctggtgagccaagggtgaccagggccctgaactcggtggcccagctttgagggaagcaaaattgttctcaattgtggaagaggagaatttggacagcagaacaaaaaaggaagacagcctcttggagcagatacatttgtcacaggaagccacatcaaaccctggggcctttgctgggcctctccatctgcccagttactgggaggtagatagccccaggaaggaatccagtcaggcctgggcaccaggccaggagtggataaagctagaaagagacaccacagaagagaagatgtttgaacagctgaagccaatcgaacctgtacagaagacgctcccatgggtgggcgaggtagctgccaccctgcaggaagccatgaagagagattgctggagggaggcacgggtgaagaagaagccagtcacctttgaggatgtggcagtgaatttcacccaggaagagtgggactgtctagatgccagccagagggtcctttaccaggatgttatgtcggaaacctttaagaatctaacatctgtggccagaatctttctgcataagccagagctaatcaccaagcttgagcaagaagaggaacagtggagagagtttgtccatctcccaaacacagaaggcctttcagaaggcaagaagaaagagcttcgagaacaacatcccagtctgagagatgaggggactagtgatgacaaggtcttccttgcatgcagaggggccggccagtgccccctatctgccccagctgggactatggacaggacccgggtgcttcaagcatcccaggctgggccaccctttttttgctacacctgtggcaaatgtttcagcaggcgctcctacctctatagccaccagtttgttcacaatcccaagctgactaacagctgcagtcagtgtgggaagttgtttcggagccccaagtccctcagctatcacagacgcatgcatcttggggagaggcccttctgttgcacgctctgtgacaagacctactgtgatgcttctggactaagtcgtcaccgccgcgtccatctgggttaccggccccattcatgctctgtgtgtgggaagagcttccgggaccagtctgagctcaaacgccaccagaagatacaccaaaaccaggagccagtggatggaaaccaggagtgtactttgaggattccaggcacccaggctgaattccagacacccatcgccagaagccagaggtccatccaggggcttttggatgtgaaccatgcaccagtggccaggtcccaggaacccatatttagaactgagggtcctatggcccagaaccaggcatctgtacttaagaaccaagcacctgtgaccaggacccaggcacccatcactggaaccctctgtcaggatgccagatccaactctcatccagtgaagccctcaagactcaatgtcttctgttgcccccattgttctttgacttttagcaagaaatcctatctctccagacaccagaaggcccacctcacagagccgcccaactactgcttccattgcagcaagtctttcagctcattttccaggctggtcagacaccagcagacccactggaagcagaagagctacctttgccctatctgtgacctctcctttggggagaaagagggccttatggatcactggaggggctataaaggcaaggacctgtgccagagcagccaccataaatgccgggtgatcctgggccagtggcttggcttctctcatgatgtccccactatggctggggaggaatggaagcatggaggtgatcaatctccccccaggatccatacccccaggagaagaggcctaagagagaaggcctgcaaaggagacaaaacaaaggaggcagtgagcatcttgaaacataaataaatggcctttctgactga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]