2025-09-19 14:22:05, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001109601 1324 bp mRNA linear ROD 26-FEB-2024 DEFINITION Rattus norvegicus Tcl1 family Akt coactivator A (Tcl1a), mRNA. ACCESSION NM_001109601 XM_001074847 VERSION NM_001109601.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1324) AUTHORS Nishimura K, Aizawa S, Nugroho FL, Shiomitsu E, Tran YTH, Bui PL, Borisova E, Sakuragi Y, Takada H, Kurisaki A, Hayashi Y, Fukuda A, Nakanishi M and Hisatake K. TITLE A Role for KLF4 in Promoting the Metabolic Shift via TCL1 during Induced Pluripotent Stem Cell Generation JOURNAL Stem Cell Reports 8 (3), 787-801 (2017) PUBMED 28262547 REFERENCE 2 (bases 1 to 1324) AUTHORS Loh YH, Zhang W, Chen X, George J and Ng HH. TITLE Jmjd1a and Jmjd2c histone H3 Lys 9 demethylases regulate self-renewal in embryonic stem cells JOURNAL Genes Dev 21 (20), 2545-2557 (2007) PUBMED 17938240 REFERENCE 3 (bases 1 to 1324) AUTHORS Ivanova N, Dobrin R, Lu R, Kotenko I, Levorse J, DeCoste C, Schafer X, Lun Y and Lemischka IR. TITLE Dissecting self-renewal in stem cells with RNA interference JOURNAL Nature 442 (7102), 533-538 (2006) PUBMED 16767105 REFERENCE 4 (bases 1 to 1324) AUTHORS Narducci MG, Fiorenza MT, Kang SM, Bevilacqua A, Di Giacomo M, Remotti D, Picchio MC, Fidanza V, Cooper MD, Croce CM, Mangia F and Russo G. TITLE TCL1 participates in early embryonic development and is overexpressed in human seminomas JOURNAL Proc Natl Acad Sci U S A 99 (18), 11712-11717 (2002) PUBMED 12181493 REFERENCE 5 (bases 1 to 1324) AUTHORS Laine J, Kunstle G, Obata T, Sha M and Noguchi M. TITLE The protooncogene TCL1 is an Akt kinase coactivator JOURNAL Mol Cell 6 (2), 395-407 (2000) PUBMED 10983986 REFERENCE 6 (bases 1 to 1324) AUTHORS Pekarsky Y, Hallas C, Isobe M, Russo G and Croce CM. TITLE Abnormalities at 14q32.1 in T cell malignancies involve two oncogenes JOURNAL Proc Natl Acad Sci U S A 96 (6), 2949-2951 (1999) PUBMED 10077617 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473982.1. On Oct 4, 2007 this sequence version replaced XM_001074847.1. ##Evidence-Data-START## RNAseq introns :: partial sample support SAMEA5760383 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1324 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="6" /map="6q32" gene 1..1324 /gene="Tcl1a" /gene_synonym="Tcl1" /note="Tcl1 family Akt coactivator A" /db_xref="GeneID:690575" /db_xref="RGD:1594686" exon 1..181 /gene="Tcl1a" /gene_synonym="Tcl1" /inference="alignment:Splign:2.1.0" CDS 62..400 /gene="Tcl1a" /gene_synonym="Tcl1" /note="T-cell leukemia/lymphoma protein 1A (P14 TCL1 protein) (TCL1 oncogene) (TCL-1 protein); T-cell lymphoma breakpoint 1; T-cell leukemia/lymphoma 1A" /codon_start=1 /product="T-cell leukemia/lymphoma protein 1A" /protein_id="NP_001103071.1" /db_xref="GeneID:690575" /db_xref="RGD:1594686" /translation="
MANQLAYRPETPPHPDRLWLWEKHVYLDEFRRSWLPIVIKSNGKFQVIMRQKDVILGDSMTPSQLVPYELPLMWQLYPEERYRSSNSEFWQIVYHIKFKDDEDMLLELLDSE"
misc_feature 62..391 /gene="Tcl1a" /gene_synonym="Tcl1" /note="TCL1/MTCP1 family; Region: TCL1_MTCP1; pfam01840" /db_xref="CDD:460358" exon 182..352 /gene="Tcl1a" /gene_synonym="Tcl1" /inference="alignment:Splign:2.1.0" exon 353..412 /gene="Tcl1a" /gene_synonym="Tcl1" /inference="alignment:Splign:2.1.0" exon 413..1324 /gene="Tcl1a" /gene_synonym="Tcl1" /inference="alignment:Splign:2.1.0" ORIGIN
ggaagtcgctttatcacggactggcattgcaattttttgcttcttgctccgaccggatgccatggctaaccagctggcatacaggccagagacacccccacaccccgaccgcctgtggctctgggagaagcacgtgtacttggatgaatttcgtcgcagctggttgccgatagtcatcaagagtaacggaaaattccaggtgatcatgcgacagaaagatgtcatcttgggggattccatgaccccaagtcagctggtgccgtatgagctgcctttaatgtggcagctataccctgaggaaaggtaccgaagcagtaactccgagttctggcagatagtgtaccacatcaagttcaaagatgatgaggacatgctacttgaactgttggactctgagtaacgttgagacatggccctgcagctcctgtctcccttgcccaggcctgagcccacaggggagatgctggtacttacatttgctctgttggctaggcatgttctttctcctccacactgggctccaagaagaaaagtccatccagaggctgccccttcccatgttcctgtcgcccgctctgctgccttggttggcccttccactctaccggctccctggcaaggggttcagggaagatccccattctcctcacctcctctaggtgcccagtggtgtctgcacctctgatcttctcagctgattgattttttttttctgcctttcccttttgcctctcaagacaactagtgtctggcttgccagtttgccttcccaaggggccctcagttgtacatatgccatgagggacgagaccaagtcatttgaatccggcagaccccaggtccgccatctctcaaggtgtgctgtggcgcctgtacccacctggcctgtgaaccgtcacctacccaacaaatgcagacgtggttggaaagcagtttaagaccagagagctccatttccctgtcgtagaacccgggtgcttgcagccagggatatgcaaacctcactagagcaggaggccagggaatggagctgatttagatgagcccttagcttgcccactcttggcctctctcccttggtgttcagatactgtattgaatataagcacttcctgttaaccgattaaatatctcactcacctaagttgggccgaactggcttctatccttgaccaagatgccaagaaataagagagaagactgctctgggttctcccagagaagccgtggtcttccagtaagaatgttgaaagggaatgtgtgggattttatatgtttctattttagagataaggccagacttaataaagctttatagaactct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]