GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 16:31:11, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001109601            1324 bp    mRNA    linear   ROD 01-FEB-2021
DEFINITION  Rattus norvegicus Tcl1 family Akt coactivator A (Tcl1a), mRNA.
ACCESSION   NM_001109601 XM_001074847
VERSION     NM_001109601.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1324)
  AUTHORS   Nishimura K, Aizawa S, Nugroho FL, Shiomitsu E, Tran YTH, Bui PL,
            Borisova E, Sakuragi Y, Takada H, Kurisaki A, Hayashi Y, Fukuda A,
            Nakanishi M and Hisatake K.
  TITLE     A Role for KLF4 in Promoting the Metabolic Shift via TCL1 during
            Induced Pluripotent Stem Cell Generation
  JOURNAL   Stem Cell Reports 8 (3), 787-801 (2017)
   PUBMED   28262547
REFERENCE   2  (bases 1 to 1324)
  AUTHORS   Loh YH, Zhang W, Chen X, George J and Ng HH.
  TITLE     Jmjd1a and Jmjd2c histone H3 Lys 9 demethylases regulate
            self-renewal in embryonic stem cells
  JOURNAL   Genes Dev. 21 (20), 2545-2557 (2007)
   PUBMED   17938240
REFERENCE   3  (bases 1 to 1324)
  AUTHORS   Ivanova N, Dobrin R, Lu R, Kotenko I, Levorse J, DeCoste C, Schafer
            X, Lun Y and Lemischka IR.
  TITLE     Dissecting self-renewal in stem cells with RNA interference
  JOURNAL   Nature 442 (7102), 533-538 (2006)
   PUBMED   16767105
REFERENCE   4  (bases 1 to 1324)
  AUTHORS   Narducci MG, Fiorenza MT, Kang SM, Bevilacqua A, Di Giacomo M,
            Remotti D, Picchio MC, Fidanza V, Cooper MD, Croce CM, Mangia F and
            Russo G.
  TITLE     TCL1 participates in early embryonic development and is
            overexpressed in human seminomas
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (18), 11712-11717 (2002)
   PUBMED   12181493
REFERENCE   5  (bases 1 to 1324)
  AUTHORS   Laine J, Kunstle G, Obata T, Sha M and Noguchi M.
  TITLE     The protooncogene TCL1 is an Akt kinase coactivator
  JOURNAL   Mol. Cell 6 (2), 395-407 (2000)
   PUBMED   10983986
REFERENCE   6  (bases 1 to 1324)
  AUTHORS   Pekarsky Y, Hallas C, Isobe M, Russo G and Croce CM.
  TITLE     Abnormalities at 14q32.1 in T cell malignancies involve two
            oncogenes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 96 (6), 2949-2951 (1999)
   PUBMED   10077617
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473982.1.
            On Oct 4, 2007 this sequence version replaced XM_001074847.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: mixed/partial sample support SAMEA5760383
                              [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1324
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="6"
                     /map="6q32"
     gene            1..1324
                     /gene="Tcl1a"
                     /gene_synonym="Tcl1"
                     /note="Tcl1 family Akt coactivator A"
                     /db_xref="GeneID:690575"
                     /db_xref="RGD:1594686"
     exon            1..181
                     /gene="Tcl1a"
                     /gene_synonym="Tcl1"
                     /inference="alignment:Splign:2.0.8"
     CDS             62..400
                     /gene="Tcl1a"
                     /gene_synonym="Tcl1"
                     /note="T-cell leukemia/lymphoma protein 1A (P14 TCL1
                     protein) (TCL1 oncogene) (TCL-1 protein); T-cell lymphoma
                     breakpoint 1; T-cell leukemia/lymphoma 1A"
                     /codon_start=1
                     /product="T-cell leukemia/lymphoma protein 1A"
                     /protein_id="NP_001103071.1"
                     /db_xref="GeneID:690575"
                     /db_xref="RGD:1594686"
                     /translation="
MANQLAYRPETPPHPDRLWLWEKHVYLDEFRRSWLPIVIKSNGKFQVIMRQKDVILGDSMTPSQLVPYELPLMWQLYPEERYRSSNSEFWQIVYHIKFKDDEDMLLELLDSE"
     misc_feature    62..391
                     /gene="Tcl1a"
                     /gene_synonym="Tcl1"
                     /note="TCL1/MTCP1 family; Region: TCL1_MTCP1; pfam01840"
                     /db_xref="CDD:280084"
     exon            182..352
                     /gene="Tcl1a"
                     /gene_synonym="Tcl1"
                     /inference="alignment:Splign:2.0.8"
     exon            353..412
                     /gene="Tcl1a"
                     /gene_synonym="Tcl1"
                     /inference="alignment:Splign:2.0.8"
     exon            413..1324
                     /gene="Tcl1a"
                     /gene_synonym="Tcl1"
                     /inference="alignment:Splign:2.0.8"
ORIGIN      
ggaagtcgctttatcacggactggcattgcaattttttgcttcttgctccgaccggatgccatggctaaccagctggcatacaggccagagacacccccacaccccgaccgcctgtggctctgggagaagcacgtgtacttggatgaatttcgtcgcagctggttgccgatagtcatcaagagtaacggaaaattccaggtgatcatgcgacagaaagatgtcatcttgggggattccatgaccccaagtcagctggtgccgtatgagctgcctttaatgtggcagctataccctgaggaaaggtaccgaagcagtaactccgagttctggcagatagtgtaccacatcaagttcaaagatgatgaggacatgctacttgaactgttggactctgagtaacgttgagacatggccctgcagctcctgtctcccttgcccaggcctgagcccacaggggagatgctggtacttacatttgctctgttggctaggcatgttctttctcctccacactgggctccaagaagaaaagtccatccagaggctgccccttcccatgttcctgtcgcccgctctgctgccttggttggcccttccactctaccggctccctggcaaggggttcagggaagatccccattctcctcacctcctctaggtgcccagtggtgtctgcacctctgatcttctcagctgattgattttttttttctgcctttcccttttgcctctcaagacaactagtgtctggcttgccagtttgccttcccaaggggccctcagttgtacatatgccatgagggacgagaccaagtcatttgaatccggcagaccccaggtccgccatctctcaaggtgtgctgtggcgcctgtacccacctggcctgtgaaccgtcacctacccaacaaatgcagacgtggttggaaagcagtttaagaccagagagctccatttccctgtcgtagaacccgggtgcttgcagccagggatatgcaaacctcactagagcaggaggccagggaatggagctgatttagatgagcccttagcttgcccactcttggcctctctcccttggtgttcagatactgtattgaatataagcacttcctgttaaccgattaaatatctcactcacctaagttgggccgaactggcttctatccttgaccaagatgccaagaaataagagagaagactgctctgggttctcccagagaagccgtggtcttccagtaagaatgttgaaagggaatgtgtgggattttatatgtttctattttagagataaggccagacttaataaagctttatagaactct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]