GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 15:54:19, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001109366             636 bp    mRNA    linear   ROD 08-OCT-2016
DEFINITION  Rattus norvegicus claudin 34A (Cldn34a), mRNA.
ACCESSION   NM_001109366 XM_001064790 XM_001068935
VERSION     NM_001109366.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH474014.2.
            On or before Oct 4, 2007 this sequence version replaced
            XM_001064790.1, XM_001068935.1.
FEATURES             Location/Qualifiers
     source          1..636
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq13"
     gene            1..636
                     /gene="Cldn34a"
                     /note="claudin 34A"
                     /db_xref="GeneID:503435"
                     /db_xref="RGD:1594343"
     CDS             1..636
                     /gene="Cldn34a"
                     /codon_start=1
                     /product="claudin 34A"
                     /protein_id="NP_001102836.1"
                     /db_xref="GeneID:503435"
                     /db_xref="RGD:1594343"
                     /translation="
MILFNKGSSCQVGGFALSTIAWILCITSMGLPQWRVWYSKEPVISYPTVAFVGVWKTCIYHHDNFSNIRMCYQYSYHDTFVPLDIRVAQHLMLITCIFCLIGKAATVVALRNVYTGRQERDVTYNAFGLSAVLNIIASSFVFLAVLCNYFSIINNEGIAFPPSFHMPFYPHIQQVGIAMVVAFLAAILFLCSGVIFISFTFPLNIQVLPNI"
ORIGIN      
atgatattgttcaacaaaggttccagttgccaggtaggaggttttgctttgtccaccatagcatggattctttgcatcacttccatgggcctcccacagtggcgagtgtggtactcgaaggaacctgtgatctcttaccctactgtggcctttgtgggagtgtggaaaacctgcatctaccaccatgacaacttcagcaatattagaatgtgttaccaatacagctaccatgacaccttcgttcctttggatattcgtgttgctcagcacctgatgttgatcacctgcattttctgcctgattggaaaagcagccactgttgttgctcttagaaatgtgtacacaggaagacaagagcgggatgtcacctacaatgcctttggcctttcagcggttctgaacatcattgccagtagctttgtcttccttgctgtcttgtgcaattatttctccatcataaacaatgaagggattgcttttccaccatctttccatatgcctttttacccacatattcagcaggttggcattgccatggtagtggcatttctagcagccatcctgtttttgtgcagtggtgtgattttcatttctttcacatttcccttaaacatacaagttcttcctaatatctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]