2025-09-18 23:21:39, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001109143 745 bp mRNA linear ROD 23-MAR-2023 DEFINITION Rattus norvegicus claudin domain containing 2 (Cldnd2), mRNA. ACCESSION NM_001109143 XM_001080337 XM_574434 VERSION NM_001109143.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 745) AUTHORS Gaudet P, Livstone MS, Lewis SE and Thomas PD. TITLE Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium JOURNAL Brief Bioinform 12 (5), 449-462 (2011) PUBMED 21873635 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473979.2. On or before Oct 4, 2007 this sequence version replaced XM_001080337.1, XM_574434.2. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..745 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="1" /map="1q22" gene 1..745 /gene="Cldnd2" /gene_synonym="RGD1566413" /note="claudin domain containing 2" /db_xref="GeneID:499140" /db_xref="RGD:1566413" exon 1..105 /gene="Cldnd2" /gene_synonym="RGD1566413" /inference="alignment:Splign:2.1.0" misc_feature 2..4 /gene="Cldnd2" /gene_synonym="RGD1566413" /note="upstream in-frame stop codon" exon 106..287 /gene="Cldnd2" /gene_synonym="RGD1566413" /inference="alignment:Splign:2.1.0" CDS 119..622 /gene="Cldnd2" /gene_synonym="RGD1566413" /codon_start=1 /product="claudin domain-containing protein 2" /protein_id="NP_001102613.1" /db_xref="GeneID:499140" /db_xref="RGD:1566413" /translation="
MGVKKSLQTGGNLLNLLSSVLTVLSTTTSYWIRQQGGHSGLWQECTHGVCSNMPCQNTLAVTTACMVLAAAFSIVALGMGIRIQCQEAESLRSQNTIVLLFLSGLLLLIALTVYTAKNAWKPEVFFSWSYFFGWLALPFSFIAGFCFLLADMIMQSTEAISGFPVCL"
misc_feature 185..550 /gene="Cldnd2" /gene_synonym="RGD1566413" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" exon 288..428 /gene="Cldnd2" /gene_synonym="RGD1566413" /inference="alignment:Splign:2.1.0" exon 429..548 /gene="Cldnd2" /gene_synonym="RGD1566413" /inference="alignment:Splign:2.1.0" exon 549..745 /gene="Cldnd2" /gene_synonym="RGD1566413" /inference="alignment:Splign:2.1.0" ORIGIN
ttaaaaggctgctaggggagagggttctggaatctctgcggcctcacagagaaccatcctcccttcccccaaccccgtgggctctctgtcccaggggaccaggctctgcctccttggcatgggggtgaagaagagccttcagactggaggcaatttgcttaatctcttgagcagcgtcctcacagtactatccactactaccagctactggatccgacaacaagggggacacagtggcctatggcaggagtgtacccatggcgtctgctccaacatgccctgccagaacaccttggcagtgaccacagcatgcatggtgctggcagcagccttcagtatcgtagctttggggatggggataaggattcagtgtcaagaggccgagtcactacgtagccaaaataccattgtcttactttttctcagcgggctgctgctgctgattgcattgaccgtatacactgcaaagaatgcctggaagccagaagtcttcttctcctggtcctactttttcggatggttggctttacccttctcgtttattgcgggcttctgctttctgcttgccgacatgatcatgcagagcaccgaagccatcagcgggttcccagtgtgcctgtgaatgcggcctgcctggggcagaataaaggaatggcttttagcatcgtccctgcgtgcttttctgcggaacgtagagacataagcttgaagactacagggacacggataaagtgacttgtagaga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]