GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 11:31:37, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       NM_001108390            2110 bp    mRNA    linear   ROD 01-FEB-2021
DEFINITION  Rattus norvegicus Nedd4 family interacting protein 2 (Ndfip2),
            mRNA.
ACCESSION   NM_001108390 XM_001077197 XM_341374
VERSION     NM_001108390.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2110)
  AUTHORS   Foot NJ, Dalton HE, Shearwin-Whyatt LM, Dorstyn L, Tan SS, Yang B
            and Kumar S.
  TITLE     Regulation of the divalent metal ion transporter DMT1 and iron
            homeostasis by a ubiquitin-dependent mechanism involving Ndfips and
            WWP2
  JOURNAL   Blood 112 (10), 4268-4275 (2008)
   PUBMED   18776082
REFERENCE   2  (bases 1 to 2110)
  AUTHORS   Cristillo AD, Nie L, Macri MJ and Bierer BE.
  TITLE     Cloning and characterization of N4WBP5A, an inducible,
            cyclosporine-sensitive, Nedd4-binding protein in human T
            lymphocytes
  JOURNAL   J. Biol. Chem. 278 (36), 34587-34597 (2003)
   PUBMED   12796489
REFERENCE   3  (bases 1 to 2110)
  AUTHORS   Matsuda A, Suzuki Y, Honda G, Muramatsu S, Matsuzaki O, Nagano Y,
            Doi T, Shimotohno K, Harada T, Nishida E, Hayashi H and Sugano S.
  TITLE     Large-scale identification and characterization of human genes that
            activate NF-kappaB and MAPK signaling pathways
  JOURNAL   Oncogene 22 (21), 3307-3318 (2003)
   PUBMED   12761501
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CB697675.1, CO398212.1, DY565248.1, FM044778.1, DV728397.1 and
            BP495172.1.
            On Jul 9, 2010 this sequence version replaced NM_001108390.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: EV767579.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-217               CB697675.1         1-217
            218-825             CO398212.1         1-608
            826-1141            DY565248.1         388-703
            1142-1595           FM044778.1         191-644
            1596-2108           DV728397.1         147-659
            2109-2110           BP495172.1         3-4                 c
FEATURES             Location/Qualifiers
     source          1..2110
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="15"
                     /map="15q22"
     gene            1..2110
                     /gene="Ndfip2"
                     /note="Nedd4 family interacting protein 2"
                     /db_xref="GeneID:361089"
                     /db_xref="RGD:1309716"
     misc_feature    50..52
                     /gene="Ndfip2"
                     /note="upstream in-frame stop codon"
     CDS             101..1114
                     /gene="Ndfip2"
                     /codon_start=1
                     /product="NEDD4 family-interacting protein 2"
                     /protein_id="NP_001101860.2"
                     /db_xref="GeneID:361089"
                     /db_xref="RGD:1309716"
                     /translation="
MGRRRSQRACASAPSMLSSARGSPELRRRSASEAEVSAAAEGATGSEVAPPGDRGGRTRGSGRGSAATASSTGEAEGAERGADTPARKPDPEAGRMDHHQLGTGRYQVLHNEDDNSESSAPEQPSASSSAAQPVEAAASAPALDADSSPPPYSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAAAADAPQRNQEEECPPRDDFSDVEQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL"
     STS             1333..1490
                     /gene="Ndfip2"
                     /standard_name="BE097625"
                     /db_xref="UniSTS:244705"
     STS             1835..2014
                     /gene="Ndfip2"
                     /standard_name="RH142365"
                     /db_xref="UniSTS:231612"
     STS             1836..2016
                     /gene="Ndfip2"
                     /standard_name="BF415208"
                     /db_xref="UniSTS:248860"
ORIGIN      
cgcccactcccgaccggctgacaacctagagggctccccgggacttgcctgacttttccatctcctcccacctagggacaccttcggagcggggcctccgatgggacgccggcggagccagagagcatgcgcgtccgccccgagcatgctcagtagcgcgcgcggctccccggagctccgacgccgatcggcgagcgaagcggaggtctccgccgcagccgagggagcgacaggaagtgaagtggccccgccgggcgaccgcggcggcagaacgcgaggcagcggaaggggctctgcggcgacggcgtcgtcgaccggggaggccgagggagctgagcgcggggcagacacgcccgctcggaagccggaccccgaggcgggcaggatggatcaccaccagctggggactggccgctaccaggtgcttcacaacgaggacgataactcagaatcatctgccccagagcagccgtcagcttccagctcagcagcacagcctgtggaggctgctgcctcagcgccagccctggacgccgactcttctcctccaccttacagcagcatcactgtggacggtcccacaacttcagatgctgacgtgtacagtgagttttaccctgtgccccctccgtacagcgtcgctacctctctcccgacatacgatgaggctgaaaaggctaaagctgctgccctggccgctgcagcagcagacgcacctcaaagaaaccaagaggaagagtgtccacccagggatgacttcagtgatgtggagcagctcagagtaggcaatgatggcattttcatgctggcctttttcatggcattcatattcaactggcttggattctgcttatccttctgtatcaccaataccatagctggaagatacggtgctatctgtggatttggcctctcactgatcaaatggatccttattgtcaggttttcggactattttactggctatttcaatggacaatattggctttggtggatatttcttgtacttggcctgctccttttcttcagaggatttgttaattacctaaaggtcagaaacatgtctgaaagtatggcagctgcgcacagaacaagatacttcttccttctctagaggtggcgtcaacccaacattcctctcttacaccaatgtgaaatgtccaagtcgtctgtaaacctacaacttcgctaagatagactactgagcgcagaagcagatgtagtgaggggtggagcgtcggaattaaatgacagggtggtttatgctacaagccatgtctgttcattccttaattctctttggtatctcaatttattttgcacatttgcatatgtgcctgtttaaagggtatgcatatacttgaaagaatctgtaaagttgtagcagcaaagtccagtcctacttggttaatcagtgtttgatacaattggaagagttgagtactaaacagtcttccagcatgtaaatgcttctgacttgaccattagcgtaataaaaattacattattaatcttgtcaaatgctttagtttctggctcttagattcacctagtaattccacacacgaaatattctttgttatatatgatgtttattaaaacttgcagtatgattattagaaagaatttgtcagatttttaaatatgatattatttaggaaatctgtaaataaccatgcataagttgctctttacattcttttcttaaattgtgtctagatatcttttcattaattttaaattaagtaaactaaatacatagaaataaacttcattaaagatggagtggtttagggtgaactttaagaaagtatgagtataccaaatgctgtttaaagaacaagttagggccacaccagttttaggggttttcagatgagaaccttacattttaagattactcaccttacaattcttacaagaagagattgctttagaccttatatttattacatctaagacaatttaaaaaattaatttaccaaatatattctcatttgcatttgtctttccaaaagccaataaaagtatctttcagtattactgtaatcatttttttctttaaatgtttactctgttaagcttagcaaataaaatcttgttctgttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]