GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 14:42:22, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001107135             684 bp    mRNA    linear   ROD 09-APR-2021
DEFINITION  Rattus norvegicus claudin 15 (Cldn15), mRNA.
ACCESSION   NM_001107135 XM_001076934 XM_222085
VERSION     NM_001107135.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 684)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   2  (bases 1 to 684)
  AUTHORS   Fujita H, Chiba H, Yokozaki H, Sakai N, Sugimoto K, Wada T, Kojima
            T, Yamashita T and Sawada N.
  TITLE     Differential expression and subcellular localization of claudin-7,
            -8, -12, -13, and -15 along the mouse intestine
  JOURNAL   J Histochem Cytochem 54 (8), 933-944 (2006)
   PUBMED   16651389
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473973.1.
            On Mar 3, 2011 this sequence version replaced NM_001107135.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMD00155333,
                              SAMEA5760389 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-6898              CH473973.1         839046-845943       c
FEATURES             Location/Qualifiers
     source          1..684
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="12"
                     /map="12q12"
     gene            1..684
                     /gene="Cldn15"
                     /note="claudin 15"
                     /db_xref="GeneID:304388"
                     /db_xref="RGD:1310678"
     CDS             1..684
                     /gene="Cldn15"
                     /codon_start=1
                     /product="claudin-15"
                     /protein_id="NP_001100605.1"
                     /db_xref="GeneID:304388"
                     /db_xref="RGD:1310678"
                     /translation="
MSIAVETFGFFMSALGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNIDLSRKAKLLAIAGAFHILAGACGMVAISWYAVNITTDFFNPLYVGTKYELGSALYLGWSASLLSILGGICVFSTCCCDSKEDPATRVGLPYKPSTVVTARATSDESDVSFGKYGKNAYV"
     misc_feature    4..72
                     /gene="Cldn15"
                     /note="propagated from UniProtKB/Swiss-Prot (D3ZQJ0.1);
                     transmembrane region"
     misc_feature    10..531
                     /gene="Cldn15"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     misc_feature    163..165
                     /gene="Cldn15"
                     /note="Important for Na(+)-selective paracellular ion
                     transport. /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (D3ZQJ0.1); other site"
     misc_feature    190..192
                     /gene="Cldn15"
                     /note="Important for Na(+)-selective paracellular ion
                     transport. /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (D3ZQJ0.1); other site"
     misc_feature    202..204
                     /gene="Cldn15"
                     /note="Important for the formation of tight-junction
                     strand-like structures. /evidence=ECO:0000250; propagated
                     from UniProtKB/Swiss-Prot (D3ZQJ0.1); other site"
     misc_feature    223..297
                     /gene="Cldn15"
                     /note="propagated from UniProtKB/Swiss-Prot (D3ZQJ0.1);
                     transmembrane region"
     misc_feature    331..333
                     /gene="Cldn15"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56746; propagated from
                     UniProtKB/Swiss-Prot (D3ZQJ0.1); phosphorylation site"
     misc_feature    346..420
                     /gene="Cldn15"
                     /note="propagated from UniProtKB/Swiss-Prot (D3ZQJ0.1);
                     transmembrane region"
     misc_feature    436..441
                     /gene="Cldn15"
                     /note="propagated from UniProtKB/Swiss-Prot (D3ZQJ0.1);
                     Region: Important for the formation of tight-junction
                     strand-like structures. /evidence=ECO:0000250"
     misc_feature    478..546
                     /gene="Cldn15"
                     /note="propagated from UniProtKB/Swiss-Prot (D3ZQJ0.1);
                     transmembrane region"
     misc_feature    631..633
                     /gene="Cldn15"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (D3ZQJ0.1); phosphorylation site"
     misc_feature    640..642
                     /gene="Cldn15"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (D3ZQJ0.1); phosphorylation site"
     misc_feature    649..651
                     /gene="Cldn15"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (D3ZQJ0.1); phosphorylation site"
     exon            1..217
                     /gene="Cldn15"
                     /inference="alignment:Splign:2.1.0"
     exon            218..382
                     /gene="Cldn15"
                     /inference="alignment:Splign:2.1.0"
     exon            383..464
                     /gene="Cldn15"
                     /inference="alignment:Splign:2.1.0"
     exon            465..581
                     /gene="Cldn15"
                     /inference="alignment:Splign:2.1.0"
     exon            582..684
                     /gene="Cldn15"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgtcgatagctgtggagacctttggtttcttcatgtcagccctgggactgctgatgctgggggtgacccttccaaacagctactggagagtgtctaccgtccatgggaacgtcatcaccactaacaccatcttcgagaacctgtggtacagctgtgccaccgactccctgggagtctccaactgctgggacttcccgtccatgctggccctctctggctatgtccagggctgccgagctctcatgatcaccgccatcctcctgggcttcctgggcctctttctaggcatggtggggctccgctgcaccaacgtgggcaacatcgacctctccagaaaggccaagctgctggccattgcaggggccttccacatacttgctggagcctgtggcatggttgctatctcatggtatgctgtcaacatcaccaccgacttcttcaaccccctgtatgttggaaccaagtatgaactgggctctgccctctacttgggctggagcgcctctctgctctccatcctgggcggcatctgtgtcttctccacctgctgctgtgactccaaggaggacccagccaccagggtgggacttccctacaagccttctacggttgtgacagcccgagccacttccgatgaaagtgacgtcagctttggtaaatatggcaaaaatgcctacgtgtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]