GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 15:27:21, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001107112            1177 bp    mRNA    linear   ROD 02-OCT-2017
DEFINITION  Rattus norvegicus claudin 17 (Cldn17), mRNA.
ACCESSION   NM_001107112 XM_001070924 XM_221711
VERSION     NM_001107112.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1177)
  AUTHORS   Harris HJ, Davis C, Mullins JG, Hu K, Goodall M, Farquhar MJ, Mee
            CJ, McCaffrey K, Young S, Drummer H, Balfe P and McKeating JA.
  TITLE     Claudin association with CD81 defines hepatitis C virus entry
  JOURNAL   J. Biol. Chem. 285 (27), 21092-21102 (2010)
   PUBMED   20375010
REFERENCE   2  (bases 1 to 1177)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim. Biophys. Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   3  (bases 1 to 1177)
  AUTHORS   Hu YH, Warnatz HJ, Vanhecke D, Wagner F, Fiebitz A, Thamm S, Kahlem
            P, Lehrach H, Yaspo ML and Janitz M.
  TITLE     Cell array-based intracellular localization screening reveals novel
            functional features of human chromosome 21 proteins
  JOURNAL   BMC Genomics 7, 155 (2006)
   PUBMED   16780588
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473989.1.
            On or before Oct 4, 2007 this sequence version replaced
            XM_221711.4, XM_001070924.1.
FEATURES             Location/Qualifiers
     source          1..1177
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="11"
                     /map="11q11"
     gene            1..1177
                     /gene="Cldn17"
                     /note="claudin 17"
                     /db_xref="GeneID:304125"
                     /db_xref="RGD:1307462"
     misc_feature    128..130
                     /gene="Cldn17"
                     /note="upstream in-frame stop codon"
     CDS             140..814
                     /gene="Cldn17"
                     /codon_start=1
                     /product="claudin-17"
                     /protein_id="NP_001100582.1"
                     /db_xref="GeneID:304125"
                     /db_xref="RGD:1307462"
                     /translation="
MAFYPVQIAGLVLGFFGLVGTVGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMVTLQCKFYNSILALPPVLEAARALMCVAMALSLVALIIGICGMKQIECTSSSERVKAYLLGTSGVLFIVTGIFVLIPVSWTANIIIRDFYDPTIHAGQKRELGGALFLGWATAAVLFIAGGLLCGYCCCNRKEQWHGYPVSAYRVPPKDSQRKVTVPRKTSTSYV"
     misc_feature    155..685
                     /gene="Cldn17"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     STS             835..1014
                     /gene="Cldn17"
                     /standard_name="RH134682"
                     /db_xref="UniSTS:217961"
ORIGIN      
tgctgatttgggcaaacacatcatgggcagcaggagtgaagaagaccaggaaatcctctagtctagaagactcctacgcattgtgcatcttgaccatcttccttccttccaggctggaccagtaggctaaggaaagacaatggctttttatcccgttcagattgctggactagttcttggcttctttggcttggttgggacagtggggacaacacttctgcctcaatggagagtttcagctttcatcggcagcaatattattatctttgagagaatctgggaagggctttggatgaattgtatccagcaagctatggtcacgttgcagtgcaaattctataactccatattggctctccctccggtactggaagcagcgcgtgcactcatgtgtgtggccatggctctttccttggtcgctctcattatcggcatctgcggcatgaaacagattgagtgcaccagctccagtgagagggtcaaagcctacttgctgggaacgtcaggagtactctttattgtgactggtatcttcgttctgattccagtgtcctggaccgccaatatcatcatccgagatttctacgacccaaccatccacgcagggcagaagcgggaacttggaggagctctcttccttggctgggcaaccgctgctgtcctcttcattgcaggcgggctgctctgtggatactgctgctgcaacaggaaggaacagtggcatggatacccagtctctgcctaccgcgtgccaccaaaagacagccagaggaaggtcactgtgcctagaaaaacttccaccagttatgtctaaggcttgctttcaacaccagctcgtggcttatgctcagtgttttataaagtcgccccagaaactgtgagtacataaggcaggagaactacttttaagcagatttgaattgagatgaaagttatgatgtttttccctgaggaggaatataaatgacttatttggacattgggattccctgtgtgttattcggactcacgcttgttgaactcaatatttagtctaatttatagagtaaagcatcaagtatattctcagttatggtcatataattatgattactaatttttgcttgtcatgtattctaataagaaagtaaaatgttagattatagttgatatcaataaaacatacccattttcaaac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]