GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-04 12:08:16, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001106796             843 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus homeo box C12 (Hoxc12), mRNA.
ACCESSION   NM_001106796 XM_001068476 XM_235696
VERSION     NM_001106796.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 843)
  AUTHORS   Gaudet P, Livstone MS, Lewis SE and Thomas PD.
  TITLE     Phylogenetic-based propagation of functional annotations within the
            Gene Ontology consortium
  JOURNAL   Brief Bioinform 12 (5), 449-462 (2011)
   PUBMED   21873635
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH474035.2.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_001068476.1, XM_235696.1.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..843
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..843
                     /gene="Hoxc12"
                     /note="homeo box C12"
                     /db_xref="GeneID:300262"
                     /db_xref="RGD:1310539"
     CDS             1..843
                     /gene="Hoxc12"
                     /codon_start=1
                     /product="homeobox protein Hox-C12"
                     /protein_id="NP_001100266.1"
                     /db_xref="GeneID:300262"
                     /db_xref="RGD:1310539"
                     /translation="
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAEGGGGGLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYPAGGGGGDGNTGPPHDPPSCQSLESDSSSSLLNEGNKGASAGDPGSLVSPLNPGGGLSASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF"
     misc_feature    637..807
                     /gene="Hoxc12"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..604
                     /gene="Hoxc12"
                     /inference="alignment:Splign:2.1.0"
     exon            605..843
                     /gene="Hoxc12"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgggcgagcataatctcctgaatcctgggtttgtggggccgctggtgaatatccacacgggagacaccttctacttccccaacttccgcgcgtcaggggcgcaactcccggggctgccttcgctgtcctacccacgccgcgataacgtgtgctcgctgccctggccgtcggccgagccgtgcaatggctacccgcagccctatctcggcagtccggtgtctctcaacccgccttttggccgcacgtgcgagttggctcgcgtggaggatagcaagggttactaccgagagccctgcgctgagggcggcggcgggggcctaaagcgggaggagcgcgggcgcgaacccggagcgggacccggggcagcgctgctgcagctggagccgtcggggccacctgcgctcggcttcaagtacgactacccagcgggcggcggcggtggcgacggcaacacgggacccccccacgacccaccctcgtgtcagtcattggaatctgactccagttcatccctactcaacgagggcaataagggcgccagtgctggcgaccctggctctctggtatctccgttgaacccaggcggcgggctctcagccagcggcgcgccctggtacccgatccacagccgctcgcgaaagaagcgcaagccgtattcgaagttgcagctggctgagctggagggcgagtttctggtcaacgagttcatcacacgccagcgtcggagggaactctcggaccgcttgaatcttagtgatcagcaggtcaagatttggttccagaaccggagaatgaaaaagaaaagacttctgctgagagagcaagctctctccttcttctag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]