GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 14:53:12, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001106058            1331 bp    mRNA    linear   ROD 05-FEB-2018
DEFINITION  Rattus norvegicus claudin 10 (Cldn10), mRNA.
ACCESSION   NM_001106058 XM_001074876 XM_214250
VERSION     NM_001106058.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1331)
  AUTHORS   Hadj-Rabia S, Brideau G, Al-Sarraj Y, Maroun RC, Figueres ML,
            Leclerc-Mercier S, Olinger E, Baron S, Chaussain C, Nochy D, Taha
            RZ, Knebelmann B, Joshi V, Curmi PA, Kambouris M, Vargas-Poussou R,
            Bodemer C, Devuyst O, Houillier P and El-Shanti H.
  TITLE     Multiplex epithelium dysfunction due to CLDN10 mutation: the HELIX
            syndrome
  JOURNAL   Genet. Med. (2017) In press
   PUBMED   28771254
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 1331)
  AUTHORS   Klar J, Piontek J, Milatz S, Tariq M, Jameel M, Breiderhoff T,
            Schuster J, Fatima A, Asif M, Sher M, Mabert K, Fromm A, Baig SM,
            Gunzel D and Dahl N.
  TITLE     Altered paracellular cation permeability due to a rare CLDN10B
            variant causes anhidrosis and kidney damage
  JOURNAL   PLoS Genet. 13 (7), e1006897 (2017)
   PUBMED   28686597
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1331)
  AUTHORS   Zemke AC, Snyder JC, Brockway BL, Drake JA, Reynolds SD, Kaminski N
            and Stripp BR.
  TITLE     Molecular staging of epithelial maturation using secretory
            cell-specific genes as markers
  JOURNAL   Am. J. Respir. Cell Mol. Biol. 40 (3), 340-348 (2009)
   PUBMED   18757308
REFERENCE   4  (bases 1 to 1331)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim. Biophys. Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   5  (bases 1 to 1331)
  AUTHORS   Ohta H, Adachi H and Inaba M.
  TITLE     Developmental changes in the expression of tight junction protein
            claudins in murine metanephroi and embryonic kidneys
  JOURNAL   J. Vet. Med. Sci. 68 (2), 149-155 (2006)
   PUBMED   16520537
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473951.1.
            On or before Oct 4, 2007 this sequence version replaced
            XM_214250.4, XM_001074876.1.
FEATURES             Location/Qualifiers
     source          1..1331
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="15"
                     /map="15q24"
     gene            1..1331
                     /gene="Cldn10"
                     /note="claudin 10"
                     /db_xref="GeneID:290485"
                     /db_xref="RGD:1308027"
     misc_feature    226..228
                     /gene="Cldn10"
                     /note="upstream in-frame stop codon"
     CDS             250..1110
                     /gene="Cldn10"
                     /codon_start=1
                     /product="claudin-10"
                     /protein_id="NP_001099528.1"
                     /db_xref="GeneID:290485"
                     /db_xref="RGD:1308027"
                     /translation="
MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAAGSMASTALEIIAFVVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYFANLWKMCVTDSTGVANCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGVVFILSGLCSMTGCSLYANKITTEFFDPLFMEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRMGYTYNGPTSVMSSRTKYQGGEGDFKTTGPSKQFDKNAYV"
     misc_feature    424..951
                     /gene="Cldn10"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:419754"
     STS             529..1053
                     /gene="Cldn10"
                     /db_xref="UniSTS:465374"
     STS             529..1053
                     /gene="Cldn10"
                     /standard_name="Cldn10a"
                     /db_xref="UniSTS:465444"
     STS             983..1178
                     /gene="Cldn10"
                     /standard_name="RH142393"
                     /db_xref="UniSTS:231640"
     STS             999..1178
                     /gene="Cldn10"
                     /standard_name="RH129792"
                     /db_xref="UniSTS:213084"
ORIGIN      
caaaattcctctacaaagttttggtatctcagtagggaattagaaagattatttaggctatcgctaagatgcccttacttcactatacttaatcctaaattcccatacttggagccatcaaagtatgaagaattgtcacccaccctcatgggcgggctgtaacatttgtgggagtcctgtccagtggctgcatgcctaggccaccaaagcattcagtgtggactgtgacagcaggcaaggctgagcaacatgtccagggcgcagatctcagctctggtgtgtggcgttggagggtttggtgctcttgtcgctgccaccacatccaatgaatggaaagtgaccacccgagcatcgtccgtgataaccgccacctgggtttaccagggtctgtggatgaactgcgcagccggcagcatggctagcacggccttggaaatcatcgccttcgtcgtctccatctcgggctgggtgctggtgtcttccacactacccaccgactactggaaggtctccaccatcgatggcactgtcatcaccaccgccacttattttgccaacctgtggaagatgtgcgttaccgattccaccggtgtcgccaactgcaaggacttcccctccatgctggcgctggatggttacatccaggcgtgtagaggactaatgattgccgcggtcagcctgggcttcttcggttccatttttgcactctttggaatgaagtgtaccaaagtcggaggctcggataaagccaaagctaagattgcttgcttggctggggttgtattcatattgtcaggtctgtgttccatgacgggctgttccctgtacgcgaacaaaatcacaacggaattctttgatcccctctttatggagcaaaagtatgaattgggggctgccctcttcatcggatgggcaggagcttctctctgcatcattggcggtgtcatattttgcttttcaatatccgacaacaacaaaacacccagaatgggctacacgtacaatggacccacgtcagtcatgtcttcccggaccaagtatcaaggcggagaaggagattttaaaaccacaggcccttcaaaacagtttgataaaaatgcctatgtctaaagagctctggcaagccgcgtctcgagtttgttgcgcaagagaactgttctcacaatggtccttccaaggctcccctgtaattatcacttaagctgtttttttttttttaaaatatgaatttgaagaatgttgattggatgtaaatgttcttatagttatatactaatcatttttttctgttgtgcctttctataagggaaataaacaggttatttacagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]