2024-04-27 10:58:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001105979 2342 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus Mix paired-like homeobox 1 (Mixl1), mRNA. ACCESSION NM_001105979 XM_001061956 XM_222997 VERSION NM_001105979.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2342) AUTHORS Pereira LA, Wong MS, Mossman AK, Sourris K, Janes ME, Knezevic K, Hirst CE, Lim SM, Pimanda JE, Stanley EG and Elefanty AG. TITLE Pdgfralpha and Flk1 are direct target genes of Mixl1 in differentiating embryonic stem cells JOURNAL Stem Cell Res 8 (2), 165-179 (2012) PUBMED 22265737 REFERENCE 2 (bases 1 to 2342) AUTHORS Pereira LA, Wong MS, Lim SM, Sides A, Stanley EG and Elefanty AG. TITLE Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity JOURNAL PLoS One 6 (12), e28394 (2011) PUBMED 22164283 REFERENCE 3 (bases 1 to 2342) AUTHORS Zhang H, Fraser ST, Papazoglu C, Hoatlin ME and Baron MH. TITLE Transcriptional activation by the Mixl1 homeodomain protein in differentiating mouse embryonic stem cells JOURNAL Stem Cells 27 (12), 2884-2895 (2009) PUBMED 19711456 REFERENCE 4 (bases 1 to 2342) AUTHORS Lim SM, Pereira L, Wong MS, Hirst CE, Van Vranken BE, Pick M, Trounson A, Elefanty AG and Stanley EG. TITLE Enforced expression of Mixl1 during mouse ES cell differentiation suppresses hematopoietic mesoderm and promotes endoderm formation JOURNAL Stem Cells 27 (2), 363-374 (2009) PUBMED 19038793 REFERENCE 5 (bases 1 to 2342) AUTHORS Tam PP, Khoo PL, Lewis SL, Bildsoe H, Wong N, Tsang TE, Gad JM and Robb L. TITLE Sequential allocation and global pattern of movement of the definitive endoderm in the mouse embryo during gastrulation JOURNAL Development 134 (2), 251-260 (2007) PUBMED 17151016 REFERENCE 6 (bases 1 to 2342) AUTHORS Willey S, Ayuso-Sacido A, Zhang H, Fraser ST, Sahr KE, Adlam MJ, Kyba M, Daley GQ, Keller G and Baron MH. TITLE Acceleration of mesoderm development and expansion of hematopoietic progenitors in differentiating ES cells by the mouse Mix-like homeodomain transcription factor JOURNAL Blood 107 (8), 3122-3130 (2006) PUBMED 16403910 REFERENCE 7 (bases 1 to 2342) AUTHORS Mohn D, Chen SW, Dias DC, Weinstein DC, Dyer MA, Sahr K, Ducker CE, Zahradka E, Keller G, Zaret KS, Gudas LJ and Baron MH. TITLE Mouse Mix gene is activated early during differentiation of ES and F9 stem cells and induces endoderm in frog embryos JOURNAL Dev Dyn 226 (3), 446-459 (2003) PUBMED 12619131 REFERENCE 8 (bases 1 to 2342) AUTHORS Hart AH, Hartley L, Sourris K, Stadler ES, Li R, Stanley EG, Tam PP, Elefanty AG and Robb L. TITLE Mixl1 is required for axial mesendoderm morphogenesis and patterning in the murine embryo JOURNAL Development 129 (15), 3597-3608 (2002) PUBMED 12117810 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473985.1. On or before Oct 3, 2007 this sequence version replaced XM_001061956.1, XM_222997.3. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA5760434 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..2342 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="13" /map="13q26" gene 1..2342 /gene="Mixl1" /note="Mix paired-like homeobox 1" /db_xref="GeneID:289311" /db_xref="RGD:1310011" exon 1..415 /gene="Mixl1" /inference="alignment:Splign:2.1.0" CDS 23..718 /gene="Mixl1" /codon_start=1 /product="homeobox protein MIXL1" /protein_id="NP_001099449.1" /db_xref="GeneID:289311" /db_xref="RGD:1310011" /translation="
MAAAGSQQLQFAEGAAFPTFPAAHPGGQLLPAARPATGLPPAPPDSRAPAATPCFPSRGPRPAAQTPTGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRREDFLHRPAPGTEARCLKPQLPLEADVNHVLDSSMAGGGVCTSGSQGFETYSSLSEDIGSKLDSWEEHIFSALGSF"
misc_feature <26..439 /gene="Mixl1" /note="DNA polymerase III subunit gamma/tau; Region: PRK14971" /db_xref="CDD:237874" misc_feature 278..448 /gene="Mixl1" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(281..295,299..301,350..352,368..370,407..409, 413..418,425..430,434..442,446..451) /gene="Mixl1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(287..289,296..298,416..418,425..430,437..439) /gene="Mixl1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 416..2342 /gene="Mixl1" /inference="alignment:Splign:2.1.0" ORIGIN
tcccgggaaacgtcccggagtgatggccgcagcagggtcccagcagcttcagttcgcagagggcgccgctttccccaccttcccggccgcgcaccccggaggacagctgctcccggccgcgcgcccagccactgggctacccccggcgcccccggactctcgcgccccagcggccacgccatgctttccaagccggggccccaggcccgcagcgcagactcccaccggcctggatccgcccggaccctccaaaggctcggccgccccgtctgcgccgcagcgccgcaagcgcacgtcgttcagctccgagcagctgcagttgctggagctcgtcttccgacagaccatgtaccccgacatccacttgcgggagcgtctggctgcgctcacgctgctacccgagtcaaggatccaggtgtggttccagaacagacgggccaagtcccggcgtcagagcgggaagtcgtttcagcccttatcctcaaggcgggaagatttcctccatcgtcctgctccggggactgaagcaaggtgtctgaagcctcagttgcctctagaggcggatgtgaaccacgttctggattccagtatggctggaggaggcgtctgtacatctggttctcagggttttgaaacttactcctctctctctgaagatattggctcaaagttggactcatgggaggagcacatcttttctgccttgggtagcttctgaggattctgggagagttcaagatgtactcagggagatctgggagattcgaaccagaccctgtctgatctcctgactggccaggtcttggttctggatcacctctcatatttaggtttcccttctccgacacagcctttactgctggcttgttcttggtagccacccgccctcccacccgcaagtcactgtgaatctccaagactgcacattatcatcggtctacatcccctgggccttctcactagggttattctcgttttccagactgattattcaaaatttgctttcctcataggaacctccagctggattcaatttctcccctttctcggcagctgcctacaacgtgggttcactctctctcacccaaatccttatcaccaagacttagtactttttattgaatctttttgttttgtttttgaccttgctgtgtaagtaaggatggcatgaactcctgtcctcccacctctatttgccatcgtgactgactggatgttgctatttttgcttaaaattgtgtatgatattaagatatatatccaaatcaagcttaacacatgcatgagatcagtcaccttccttttttctgcgatgatacaatctattagcaatttcaagtatatgaaatatcgatactaactctagccattaccattgagttcttcagcttctctctcctagctgactgagtatcctagccacctcccctgccctcacttgactggtttctcgtctggcctgtcaactttacactccatcagtaaagatgctactttcaacctctttcaagaaccccatgcctcttgttccccactttctttctttctttttcttttttttttttggttctttttttttttcggagctggggactgaacccagggccttgcgcttcctaggtaagcgctctaccactgagctaaatccccagcccctctttctttcttttttaaattactctatttggaaatctgtggcagcatccagttaccaaaccataagaccctgtcaagcacgctcctagtcaatgacatcatctttagcttatgcaaactttaagatcatttacccacaatgtgcttctctgtctgtctctgtctgtcattcctttctagttgggactcagtgagaaagcttctctttcaaaacagctcaagcacaccgctttctgaagcctgaacttttcttaactaatcctgtttttcgtacctgttactttgatgaccatttttcttagcacttgttcttattatgtttcctgtacaacattagtggattactaaatgctcctcactgccgttttttacatgaatcccattgaaatgagccctgttttcccagacctcagcactgggaaagttggggaatacataatgaatgacagaaaacattctgaagggaactttctgcacacacagtacatcgagaatttatttgagcacgcttatctgctgggctgctgagatagctcagtggaggtaaacatgttgtcaccaagcatgacaatctgagtttgatccccaagacccacatggtgagaaggagaatggatttgtcttttagacttccacatgtgtgctatggtgtatacccacatacatacacacatacaaaataaata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]