2025-07-08 21:09:53, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001105746 2231 bp mRNA linear ROD 24-JUN-2024 DEFINITION Rattus norvegicus POU class 6 homeobox 1 (Pou6f1), mRNA. ACCESSION NM_001105746 XM_001064836 XM_343334 VERSION NM_001105746.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2231) AUTHORS Li,W.Y., Li,Z.G., Fu,X.M., Wang,X.Y., Lv,Z.X., Sun,P., Zhu,X.F. and Wang,Y. TITLE Transgenic Schwann cells overexpressing POU6F1 promote sciatic nerve regeneration within acellular nerve allografts JOURNAL J Neural Eng 19 (6) (2022) PUBMED 36317259 REMARK GeneRIF: Transgenic Schwann cells overexpressing POU6F1 promote sciatic nerve regeneration within acellular nerve allografts. Publication Status: Online-Only REFERENCE 2 (bases 1 to 2231) AUTHORS Toda,K., Yamamoto,D., Fumoto,M., Ikeshita,N., Herningtyas,E.H., Iida,K., Takahashi,Y., Kaji,H., Chihara,K. and Okimura,Y. TITLE Involvement of mPOU (Brn-5), a class VI POU protein, in the gene expression of Pit-1 as well as PRL JOURNAL Mol Cell Endocrinol 280 (1-2), 20-29 (2008) PUBMED 17933456 REMARK GeneRIF: Brn-5 enhances prolactin gene expression directly in association with Pit-1 and CREB-binding protein, and indirectly via the activation of Pit-1 gene expression. REFERENCE 3 (bases 1 to 2231) AUTHORS Molinari,S., Relaix,F., Lemonnier,M., Kirschbaum,B., Schafer,B. and Buckingham,M. TITLE A novel complex regulates cardiac actin gene expression through interaction of Emb, a class VI POU domain protein, MEF2D, and the histone transacetylase p300 JOURNAL Mol Cell Biol 24 (7), 2944-2957 (2004) PUBMED 15024082 REFERENCE 4 (bases 1 to 2231) AUTHORS Cui,H. and Bulleit,R.F. TITLE Expression of the POU transcription factor Brn-5 is an early event in the terminal differentiation of CNS neurons JOURNAL J Neurosci Res 52 (6), 625-632 (1998) PUBMED 9669311 REFERENCE 5 (bases 1 to 2231) AUTHORS Wey,E. and Schafer,B.W. TITLE Identification of novel DNA binding sites recognized by the transcription factor mPOU (POU6F1) JOURNAL Biochem Biophys Res Commun 220 (2), 274-279 (1996) PUBMED 8645295 REFERENCE 6 (bases 1 to 2231) AUTHORS Wey,E., Lyons,G.E. and Schafer,B.W. TITLE A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues JOURNAL Eur J Biochem 220 (3), 753-762 (1994) PUBMED 7908264 REFERENCE 7 (bases 1 to 2231) AUTHORS Andersen,B., Schonemann,M.D., Pearse,R.V. 2nd, Jenne,K., Sugarman,J. and Rosenfeld,M.G. TITLE Brn-5 is a divergent POU domain factor highly expressed in layer IV of the neocortex JOURNAL J Biol Chem 268 (31), 23390-23398 (1993) PUBMED 7901208 REFERENCE 8 (bases 1 to 2231) AUTHORS Okamoto,K., Wakamiya,M., Noji,S., Koyama,E., Taniguchi,S., Takemura,R., Copeland,N.G., Gilbert,D.J., Jenkins,N.A., Muramatsu,M. et al. TITLE A novel class of murine POU gene predominantly expressed in central nervous system JOURNAL J Biol Chem 268 (10), 7449-7457 (1993) PUBMED 8463278 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CH474035.2. On or before Oct 3, 2007 this sequence version replaced XM_343334.3, XM_001064836.1. ##Evidence-Data-START## Transcript exon combination :: L23204.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132265, SAMD00132285 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on computational evidence ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..2231 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..2231 /gene="Pou6f1" /gene_synonym="Brn5" /note="POU class 6 homeobox 1" /db_xref="GeneID:116545" /db_xref="RGD:620615" exon 1..845 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" misc_feature 690..692 /gene="Pou6f1" /gene_synonym="Brn5" /note="upstream in-frame stop codon" CDS 801..1706 /gene="Pou6f1" /gene_synonym="Brn5" /note="brain-5; brn-5 protein; brain-specific homeobox/POU domain protein 5" /codon_start=1 /product="POU domain, class 6, transcription factor 1" /protein_id="NP_001099216.1" /db_xref="GeneID:116545" /db_xref="RGD:620615" /translation="
MPGISSPILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVILTSPAPALKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP"
misc_feature 831..968 /gene="Pou6f1" /gene_synonym="Brn5" /note="propagated from UniProtKB/Swiss-Prot (P56223.1); Region: 2 X 7 AA repeats of N-A-Q-G-Q-V-I" misc_feature <867..1265 /gene="Pou6f1" /gene_synonym="Brn5" /note="DNA polymerase III subunit gamma/tau; Region: PRK12323; cl46901" /db_xref="CDD:481241" misc_feature 996..1064 /gene="Pou6f1" /gene_synonym="Brn5" /note="propagated from UniProtKB/Swiss-Prot (P56223.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1215..1439 /gene="Pou6f1" /gene_synonym="Brn5" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:473999" misc_feature 1503..1673 /gene="Pou6f1" /gene_synonym="Brn5" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 846..1049 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" exon 1050..1191 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" exon 1192..1360 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" exon 1361..2231 /gene="Pou6f1" /gene_synonym="Brn5" /inference="alignment:Splign:2.1.0" ORIGIN
cggaaagatttctgcagcagtgctccccttccctgtgactgtgctccccttccctgtgactgtgctcccctcccctatgactatgctcttcctcccctgtgactgtgctccccttccccaagactgtgctccctttctttcaactgtatttcccctcctgtgactgtgctccccttcccagagactgtgctctcctgtgactgtgctcctcttctctgagactgtgctcccttcccccaagactatgttccccttcccagagactgtgttcccctcccctatcactgtgttcccctcccctgttactgtgctcccttcccctgtgactctgctctcctcccctgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctcccctcccccgtcactatgctctcctcccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccctgctatccccctgtacttgtctccctagtcttgagtaccagccagtggactagagcctgcagcccagtaccctcagccctcttccctctctgtgccctttcttgcctctcggtctctgagcaaggctcttcctccacccacagatcagtgccgcgtcccttgggggacagacgcaaatcctgggctccctcactacagctccagttattaccaacaccattcccagcatgcccgggatcagcagtccgatcctcaccaatgctcagggacaggttattggagcacttccatgggtagtgaactcagccagtgtggccacaccagcaccagcacagagcctgcaggtccaagctgtgactccccagctcttgttgaatgcccagggccaggtgatcgcaacactagccagcagccccctgcctcaacctgtggctgtccggaagccaagcacaccggagtcccctgcaaagagtgaggtgcaacccatccagccgacacaagccgtgcccccacctgctgtaatcctcaccagcccagctccagcactcaagccatcagcctcagctcccatcccaatcacctgctcagagacacctacagtcagtcagttggtatcaaaaccgcacactccgagtctggatgaggacgggatcaacttagaagagatccgggagtttgccaagaattttaagatccggaggctctccctgggtctgacacagacccaggtgggccaggctctgaccgcaacagaggggccagcctacagccaatcagccatctgcaggttcgagaagttagacatcacacccaagagtgcccagaagctgaagccggttttggaaaagtggttgaacgaggcagagctccggaaccaggaaggccagcagaatctgatggagtttgtgggcggcgagccctccaagaaacgcaagcggcgtacttccttcacaccacaggccatagaggctctcaatgcctactttgagaaaaaccccctgcccaccggccaggagatcaccgagatcgctaaggagctcaactatgaccgtgaggtggtgagggtctggttctgtaatcgacgccagacactcaagaacaccagcaagctgaatgtctttcagatcccctagggctcggggtcagcgtgttccttgtgcgaatccctcagcagtcagctgaagtcactgagtggcagtactgtgggcagctgtgcttgccctcggtcatgagactccacctgtgcatgtgtgtcaatgcctgcctcttctgcccacatatgtcacaccctggggaggcccgaggggctgcatgagagccctaggctctgggctgggcatgtggaaggagggggttggtggggtccttagaaaagcactttgccgaggtggtttctgaagggtgaattctggttgagaaccaggaaggctctgtctttggggcagggccgtagcaactcttggggacaactgtgtagtggctcttggttttggtgacgtcctttcccccttcccctcactcctctgtggctgtgccggtgtgacaacacaccgggtggaactgcagcctcacactgcctcccttcctctgaatatgggcacactgaaccccctgaaaggactgaggaatccagagagtcgtggtgtgctgctcagacc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]