GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-08 21:09:53, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001105746            2231 bp    mRNA    linear   ROD 24-JUN-2024
DEFINITION  Rattus norvegicus POU class 6 homeobox 1 (Pou6f1), mRNA.
ACCESSION   NM_001105746 XM_001064836 XM_343334
VERSION     NM_001105746.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2231)
  AUTHORS   Li,W.Y., Li,Z.G., Fu,X.M., Wang,X.Y., Lv,Z.X., Sun,P., Zhu,X.F. and
            Wang,Y.
  TITLE     Transgenic Schwann cells overexpressing POU6F1 promote sciatic
            nerve regeneration within acellular nerve allografts
  JOURNAL   J Neural Eng 19 (6) (2022)
   PUBMED   36317259
  REMARK    GeneRIF: Transgenic Schwann cells overexpressing POU6F1 promote
            sciatic nerve regeneration within acellular nerve allografts.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2231)
  AUTHORS   Toda,K., Yamamoto,D., Fumoto,M., Ikeshita,N., Herningtyas,E.H.,
            Iida,K., Takahashi,Y., Kaji,H., Chihara,K. and Okimura,Y.
  TITLE     Involvement of mPOU (Brn-5), a class VI POU protein, in the gene
            expression of Pit-1 as well as PRL
  JOURNAL   Mol Cell Endocrinol 280 (1-2), 20-29 (2008)
   PUBMED   17933456
  REMARK    GeneRIF: Brn-5 enhances prolactin gene expression directly in
            association with Pit-1 and CREB-binding protein, and indirectly via
            the activation of Pit-1 gene expression.
REFERENCE   3  (bases 1 to 2231)
  AUTHORS   Molinari,S., Relaix,F., Lemonnier,M., Kirschbaum,B., Schafer,B. and
            Buckingham,M.
  TITLE     A novel complex regulates cardiac actin gene expression through
            interaction of Emb, a class VI POU domain protein, MEF2D, and the
            histone transacetylase p300
  JOURNAL   Mol Cell Biol 24 (7), 2944-2957 (2004)
   PUBMED   15024082
REFERENCE   4  (bases 1 to 2231)
  AUTHORS   Cui,H. and Bulleit,R.F.
  TITLE     Expression of the POU transcription factor Brn-5 is an early event
            in the terminal differentiation of CNS neurons
  JOURNAL   J Neurosci Res 52 (6), 625-632 (1998)
   PUBMED   9669311
REFERENCE   5  (bases 1 to 2231)
  AUTHORS   Wey,E. and Schafer,B.W.
  TITLE     Identification of novel DNA binding sites recognized by the
            transcription factor mPOU (POU6F1)
  JOURNAL   Biochem Biophys Res Commun 220 (2), 274-279 (1996)
   PUBMED   8645295
REFERENCE   6  (bases 1 to 2231)
  AUTHORS   Wey,E., Lyons,G.E. and Schafer,B.W.
  TITLE     A human POU domain gene, mPOU, is expressed in developing brain and
            specific adult tissues
  JOURNAL   Eur J Biochem 220 (3), 753-762 (1994)
   PUBMED   7908264
REFERENCE   7  (bases 1 to 2231)
  AUTHORS   Andersen,B., Schonemann,M.D., Pearse,R.V. 2nd, Jenne,K.,
            Sugarman,J. and Rosenfeld,M.G.
  TITLE     Brn-5 is a divergent POU domain factor highly expressed in layer IV
            of the neocortex
  JOURNAL   J Biol Chem 268 (31), 23390-23398 (1993)
   PUBMED   7901208
REFERENCE   8  (bases 1 to 2231)
  AUTHORS   Okamoto,K., Wakamiya,M., Noji,S., Koyama,E., Taniguchi,S.,
            Takemura,R., Copeland,N.G., Gilbert,D.J., Jenkins,N.A.,
            Muramatsu,M. et al.
  TITLE     A novel class of murine POU gene predominantly expressed in central
            nervous system
  JOURNAL   J Biol Chem 268 (10), 7449-7457 (1993)
   PUBMED   8463278
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CH474035.2.
            
            On or before Oct 3, 2007 this sequence version replaced
            XM_343334.3, XM_001064836.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L23204.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132265, SAMD00132285
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on computational evidence
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2231
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..2231
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="POU class 6 homeobox 1"
                     /db_xref="GeneID:116545"
                     /db_xref="RGD:620615"
     exon            1..845
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    690..692
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="upstream in-frame stop codon"
     CDS             801..1706
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="brain-5; brn-5 protein; brain-specific homeobox/POU
                     domain protein 5"
                     /codon_start=1
                     /product="POU domain, class 6, transcription factor 1"
                     /protein_id="NP_001099216.1"
                     /db_xref="GeneID:116545"
                     /db_xref="RGD:620615"
                     /translation="
MPGISSPILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVILTSPAPALKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP"
     misc_feature    831..968
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="propagated from UniProtKB/Swiss-Prot (P56223.1);
                     Region: 2 X 7 AA repeats of N-A-Q-G-Q-V-I"
     misc_feature    <867..1265
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="DNA polymerase III subunit gamma/tau; Region:
                     PRK12323; cl46901"
                     /db_xref="CDD:481241"
     misc_feature    996..1064
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="propagated from UniProtKB/Swiss-Prot (P56223.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1215..1439
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="Pou domain - N-terminal to homeobox domain; Region:
                     Pou; cl22952"
                     /db_xref="CDD:473999"
     misc_feature    1503..1673
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            846..1049
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1050..1191
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1192..1360
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1361..2231
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cggaaagatttctgcagcagtgctccccttccctgtgactgtgctccccttccctgtgactgtgctcccctcccctatgactatgctcttcctcccctgtgactgtgctccccttccccaagactgtgctccctttctttcaactgtatttcccctcctgtgactgtgctccccttcccagagactgtgctctcctgtgactgtgctcctcttctctgagactgtgctcccttcccccaagactatgttccccttcccagagactgtgttcccctcccctatcactgtgttcccctcccctgttactgtgctcccttcccctgtgactctgctctcctcccctgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctcccctcccccgtcactatgctctcctcccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccctgctatccccctgtacttgtctccctagtcttgagtaccagccagtggactagagcctgcagcccagtaccctcagccctcttccctctctgtgccctttcttgcctctcggtctctgagcaaggctcttcctccacccacagatcagtgccgcgtcccttgggggacagacgcaaatcctgggctccctcactacagctccagttattaccaacaccattcccagcatgcccgggatcagcagtccgatcctcaccaatgctcagggacaggttattggagcacttccatgggtagtgaactcagccagtgtggccacaccagcaccagcacagagcctgcaggtccaagctgtgactccccagctcttgttgaatgcccagggccaggtgatcgcaacactagccagcagccccctgcctcaacctgtggctgtccggaagccaagcacaccggagtcccctgcaaagagtgaggtgcaacccatccagccgacacaagccgtgcccccacctgctgtaatcctcaccagcccagctccagcactcaagccatcagcctcagctcccatcccaatcacctgctcagagacacctacagtcagtcagttggtatcaaaaccgcacactccgagtctggatgaggacgggatcaacttagaagagatccgggagtttgccaagaattttaagatccggaggctctccctgggtctgacacagacccaggtgggccaggctctgaccgcaacagaggggccagcctacagccaatcagccatctgcaggttcgagaagttagacatcacacccaagagtgcccagaagctgaagccggttttggaaaagtggttgaacgaggcagagctccggaaccaggaaggccagcagaatctgatggagtttgtgggcggcgagccctccaagaaacgcaagcggcgtacttccttcacaccacaggccatagaggctctcaatgcctactttgagaaaaaccccctgcccaccggccaggagatcaccgagatcgctaaggagctcaactatgaccgtgaggtggtgagggtctggttctgtaatcgacgccagacactcaagaacaccagcaagctgaatgtctttcagatcccctagggctcggggtcagcgtgttccttgtgcgaatccctcagcagtcagctgaagtcactgagtggcagtactgtgggcagctgtgcttgccctcggtcatgagactccacctgtgcatgtgtgtcaatgcctgcctcttctgcccacatatgtcacaccctggggaggcccgaggggctgcatgagagccctaggctctgggctgggcatgtggaaggagggggttggtggggtccttagaaaagcactttgccgaggtggtttctgaagggtgaattctggttgagaaccaggaaggctctgtctttggggcagggccgtagcaactcttggggacaactgtgtagtggctcttggttttggtgacgtcctttcccccttcccctcactcctctgtggctgtgccggtgtgacaacacaccgggtggaactgcagcctcacactgcctcccttcctctgaatatgggcacactgaaccccctgaaaggactgaggaatccagagagtcgtggtgtgctgctcagacc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]