LOCUS       NM_001105746            2231 bp    mRNA    linear   ROD 20-JUN-2021
DEFINITION  Rattus norvegicus POU class 6 homeobox 1 (Pou6f1), mRNA.
ACCESSION   NM_001105746 XM_001064836 XM_343334
VERSION     NM_001105746.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2231)
  AUTHORS   Toda K, Yamamoto D, Fumoto M, Ikeshita N, Herningtyas EH, Iida K,
            Takahashi Y, Kaji H, Chihara K and Okimura Y.
  TITLE     Involvement of mPOU (Brn-5), a class VI POU protein, in the gene
            expression of Pit-1 as well as PRL
  JOURNAL   Mol Cell Endocrinol 280 (1-2), 20-29 (2008)
   PUBMED   17933456
  REMARK    GeneRIF: Brn-5 enhances prolactin gene expression directly in
            association with Pit-1 and CREB-binding protein, and indirectly via
            the activation of Pit-1 gene expression.
REFERENCE   2  (bases 1 to 2231)
  AUTHORS   Molinari S, Relaix F, Lemonnier M, Kirschbaum B, Schafer B and
            Buckingham M.
  TITLE     A novel complex regulates cardiac actin gene expression through
            interaction of Emb, a class VI POU domain protein, MEF2D, and the
            histone transacetylase p300
  JOURNAL   Mol Cell Biol 24 (7), 2944-2957 (2004)
   PUBMED   15024082
REFERENCE   3  (bases 1 to 2231)
  AUTHORS   Cui H and Bulleit RF.
  TITLE     Expression of the POU transcription factor Brn-5 is an early event
            in the terminal differentiation of CNS neurons
  JOURNAL   J Neurosci Res 52 (6), 625-632 (1998)
   PUBMED   9669311
REFERENCE   4  (bases 1 to 2231)
  AUTHORS   Wey E and Schafer BW.
  TITLE     Identification of novel DNA binding sites recognized by the
            transcription factor mPOU (POU6F1)
  JOURNAL   Biochem Biophys Res Commun 220 (2), 274-279 (1996)
   PUBMED   8645295
REFERENCE   5  (bases 1 to 2231)
  AUTHORS   Wey E, Lyons GE and Schafer BW.
  TITLE     A human POU domain gene, mPOU, is expressed in developing brain and
            specific adult tissues
  JOURNAL   Eur J Biochem 220 (3), 753-762 (1994)
   PUBMED   7908264
REFERENCE   6  (bases 1 to 2231)
  AUTHORS   Andersen B, Schonemann MD, Pearse RV 2nd, Jenne K, Sugarman J and
            Rosenfeld MG.
  TITLE     Brn-5 is a divergent POU domain factor highly expressed in layer IV
            of the neocortex
  JOURNAL   J Biol Chem 268 (31), 23390-23398 (1993)
   PUBMED   7901208
REFERENCE   7  (bases 1 to 2231)
  AUTHORS   Okamoto K, Wakamiya M, Noji S, Koyama E, Taniguchi S, Takemura R,
            Copeland NG, Gilbert DJ, Jenkins NA, Muramatsu M et al.
  TITLE     A novel class of murine POU gene predominantly expressed in central
            nervous system
  JOURNAL   J Biol Chem 268 (10), 7449-7457 (1993)
   PUBMED   8463278
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CH474035.2.
            On or before Oct 3, 2007 this sequence version replaced
            XM_343334.3, XM_001064836.1.
            
            Summary: binds a variant octomer core motif DNA sequence; may act
            as a transcriptional activator [RGD, Feb 2006].
            
            ##Evidence-Data-START##
            Transcript exon combination :: L23204.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132265, SAMD00132285
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2231
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..2231
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="POU class 6 homeobox 1"
                     /db_xref="GeneID:116545"
                     /db_xref="RGD:620615"
     exon            1..845
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    690..692
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="upstream in-frame stop codon"
     CDS             801..1706
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="brain-5; brn-5 protein; brain-specific homeobox/POU
                     domain protein 5"
                     /codon_start=1
                     /product="POU domain, class 6, transcription factor 1"
                     /protein_id="NP_001099216.1"
                     /db_xref="GeneID:116545"
                     /db_xref="RGD:620615"
                     /translation="

MPGISSPILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVILTSPAPALKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP"

     misc_feature    831..968
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="propagated from UniProtKB/Swiss-Prot (P56223.1);
                     Region: 2 X 7 AA repeats of N-A-Q-G-Q-V-I"
     misc_feature    996..1064
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="propagated from UniProtKB/Swiss-Prot (P56223.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1215..1439
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="Pou domain - N-terminal to homeobox domain; Region:
                     Pou; cl22952"
                     /db_xref="CDD:304656"
     misc_feature    order(1503..1517,1521..1523,1572..1574,1590..1592,
                     1629..1631,1635..1640,1647..1652,1656..1664,1668..1673)
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    1509..1670
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(1509..1511,1518..1520,1638..1640,1647..1652,
                     1659..1661)
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            846..1049
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1050..1191
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1192..1360
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1361..2231
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cggaaagatttctgcagcagtgctccccttccctgtgactgtgctccccttccctgtgactgtgctcccctcccctatgactatgctcttcctcccctgtgactgtgctccccttccccaagactgtgctccctttctttcaactgtatttcccctcctgtgactgtgctccccttcccagagactgtgctctcctgtgactgtgctcctcttctctgagactgtgctcccttcccccaagactatgttccccttcccagagactgtgttcccctcccctatcactgtgttcccctcccctgttactgtgctcccttcccctgtgactctgctctcctcccctgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctcccctcccccgtcactatgctctcctcccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccctgctatccccctgtacttgtctccctagtcttgagtaccagccagtggactagagcctgcagcccagtaccctcagccctcttccctctctgtgccctttcttgcctctcggtctctgagcaaggctcttcctccacccacagatcagtgccgcgtcccttgggggacagacgcaaatcctgggctccctcactacagctccagttattaccaacaccattcccagcatgcccgggatcagcagtccgatcctcaccaatgctcagggacaggttattggagcacttccatgggtagtgaactcagccagtgtggccacaccagcaccagcacagagcctgcaggtccaagctgtgactccccagctcttgttgaatgcccagggccaggtgatcgcaacactagccagcagccccctgcctcaacctgtggctgtccggaagccaagcacaccggagtcccctgcaaagagtgaggtgcaacccatccagccgacacaagccgtgcccccacctgctgtaatcctcaccagcccagctccagcactcaagccatcagcctcagctcccatcccaatcacctgctcagagacacctacagtcagtcagttggtatcaaaaccgcacactccgagtctggatgaggacgggatcaacttagaagagatccgggagtttgccaagaattttaagatccggaggctctccctgggtctgacacagacccaggtgggccaggctctgaccgcaacagaggggccagcctacagccaatcagccatctgcaggttcgagaagttagacatcacacccaagagtgcccagaagctgaagccggttttggaaaagtggttgaacgaggcagagctccggaaccaggaaggccagcagaatctgatggagtttgtgggcggcgagccctccaagaaacgcaagcggcgtacttccttcacaccacaggccatagaggctctcaatgcctactttgagaaaaaccccctgcccaccggccaggagatcaccgagatcgctaaggagctcaactatgaccgtgaggtggtgagggtctggttctgtaatcgacgccagacactcaagaacaccagcaagctgaatgtctttcagatcccctagggctcggggtcagcgtgttccttgtgcgaatccctcagcagtcagctgaagtcactgagtggcagtactgtgggcagctgtgcttgccctcggtcatgagactccacctgtgcatgtgtgtcaatgcctgcctcttctgcccacatatgtcacaccctggggaggcccgaggggctgcatgagagccctaggctctgggctgggcatgtggaaggagggggttggtggggtccttagaaaagcactttgccgaggtggtttctgaagggtgaattctggttgagaaccaggaaggctctgtctttggggcagggccgtagcaactcttggggacaactgtgtagtggctcttggttttggtgacgtcctttcccccttcccctcactcctctgtggctgtgccggtgtgacaacacaccgggtggaactgcagcctcacactgcctcccttcctctgaatatgggcacactgaaccccctgaaaggactgaggaatccagagagtcgtggtgtgctgctcagacc

//