GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-29 02:32:15, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001105745            2407 bp    mRNA    linear   ROD 19-JUN-2021
DEFINITION  Rattus norvegicus POU class 2 homeobox 3 (Pou2f3), mRNA.
ACCESSION   NM_001105745 XM_001059708 XM_343378
VERSION     NM_001105745.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2407)
  AUTHORS   Glahder JA, Hansen CN, Vinther J, Madsen BS and Norrild B.
  TITLE     A promoter within the E6 ORF of human papillomavirus type 16
            contributes to the expression of the E7 oncoprotein from a
            monocistronic mRNA
  JOURNAL   J Gen Virol 84 (Pt 12), 3429-3441 (2003)
   PUBMED   14645924
REFERENCE   2  (bases 1 to 2407)
  AUTHORS   Cabral A, Fischer DF, Vermeij WP and Backendorf C.
  TITLE     Distinct functional interactions of human Skn-1 isoforms with Ese-1
            during keratinocyte terminal differentiation
  JOURNAL   J Biol Chem 278 (20), 17792-17799 (2003)
   PUBMED   12624109
REFERENCE   3  (bases 1 to 2407)
  AUTHORS   Andersen B, Weinberg WC, Rennekampff O, McEvilly RJ, Bermingham JR
            Jr, Hooshmand F, Vasilyev V, Hansbrough JF, Pittelkow MR, Yuspa SH
            and Rosenfeld MG.
  TITLE     Functions of the POU domain genes Skn-1a/i and Tst-1/Oct-6/SCIP in
            epidermal differentiation
  JOURNAL   Genes Dev 11 (14), 1873-1884 (1997)
   PUBMED   9242494
REFERENCE   4  (bases 1 to 2407)
  AUTHORS   Yukawa K, Yasui T, Yamamoto A, Shiku H, Kishimoto T and Kikutani H.
  TITLE     Epoc-1: a POU-domain gene expressed in murine epidermal basal cells
            and thymic stromal cells
  JOURNAL   Gene 133 (2), 163-169 (1993)
   PUBMED   8224904
REFERENCE   5  (bases 1 to 2407)
  AUTHORS   Andersen B, Schonemann MD, Flynn SE, Pearse RV 2nd, Singh H and
            Rosenfeld MG.
  TITLE     Skn-1a and Skn-1i: two functionally distinct Oct-2-related factors
            expressed in epidermis
  JOURNAL   Science 260 (5104), 78-82 (1993)
   PUBMED   7682011
  REMARK    Erratum:[Science. 1993 Dec 3;262(5139):1499. PMID: 8248794]
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473975.1.
            On or before Oct 3, 2007 this sequence version replaced
            XM_343378.3, XM_001059708.1.
            
            Summary: may play a role in epidermal development; variant Skn-1i
            inhibits Oct1 transactivation; variant Skn1a activates cytokeratin
            10 (K10) gene expression [RGD, Feb 2006].
            
            ##Evidence-Data-START##
            Transcript exon combination :: L23862.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA5756307, SAMEA5760383
                                           [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2407
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="8"
                     /map="8q22"
     gene            1..2407
                     /gene="Pou2f3"
                     /note="POU class 2 homeobox 3"
                     /db_xref="GeneID:116544"
                     /db_xref="RGD:621691"
     exon            1..103
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     CDS             76..1368
                     /gene="Pou2f3"
                     /note="Rov 1 pou-homeodomain protein; oct-11;
                     transcription factor Skn-1; octamer-binding transcription
                     factor 11; OTF-11; octamer-binding protein 11"
                     /codon_start=1
                     /product="POU domain, class 2, transcription factor 3"
                     /protein_id="NP_001099215.1"
                     /db_xref="GeneID:116544"
                     /db_xref="RGD:621691"
                     /translation="
MVNLEPMHTEIKMSGDVADSTDARSTFGQVESGNDRNGLDFNRQIKTEDLGDTLQQSLSHRPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLTSQAVGRPGLSGSSLEPHLEASQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGSLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNPSSAAFNSSGSWYRWNHPAYLH"
     misc_feature    460..615
                     /gene="Pou2f3"
                     /note="propagated from UniProtKB/Swiss-Prot (P42571.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    601..825
                     /gene="Pou2f3"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    820..888
                     /gene="Pou2f3"
                     /note="propagated from UniProtKB/Swiss-Prot (P42571.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(898..912,916..918,967..969,985..987,1024..1026,
                     1030..1035,1042..1047,1051..1059,1063..1068)
                     /gene="Pou2f3"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    904..1065
                     /gene="Pou2f3"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(904..906,913..915,1033..1035,1042..1047,1054..1056)
                     /gene="Pou2f3"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    1138..1314
                     /gene="Pou2f3"
                     /note="propagated from UniProtKB/Swiss-Prot (P42571.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            104..172
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            173..207
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            208..312
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            313..415
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            416..498
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            499..681
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            682..823
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            824..960
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            961..1122
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            1123..1189
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            1190..1328
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
     exon            1329..2407
                     /gene="Pou2f3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcttccccgggggccaggctggggcagcagcgagggacctgggggggcgctggctttggccccgcctggggcaggatggtgaatctggagcccatgcacacagagatcaagatgagtggggatgtcgctgattccacagatgcccgcagcacttttggtcaagtggagtcaggaaatgatcgaaatggcctagatttcaacagacagattaagacagaggatctgggtgacactttgcagcagagcctctcccacaggccatgccacctgagccaagggcctaccatgatgcctggaaaccaaatgtctggggacatggcttctctccatccacttcagcagcttgtgctggtccctggccacttacagtctgtatcccagtttctgctttcccagacccctcctgggcagcaaggtctgcagccgaatcttctctcctttccacagcaacagagcactctactcctcccacagacaggacctggcctcacctcccaggcagttggacgccctgggctgtcaggatcctctttagagccccacctggaagcttctcaacatctgccagggcccaagcatctgcctggccccggagggaatgacgaacccactgacctggaggagctggagaagttcgccaagaccttcaagcagaggcgcataaagctaggcttcacacagggggatgtgggattggcgatgggaaagctgtatggtaacgacttcagccagactaccatctcgagatttgaggccctcaacctgagtttcaagaacatgtgtaaactcaagccactgctggagaagtggctgaatgatgcagagtcctccccgtcagacccttcagcaagcactcccagctcgtaccccactctcagcgaagtatttggcaggaagaggaagaaacggaccagcatcgagaccaacatccgcctgactttggagaagcgatttcaagataaccctaaacccagctcggaagagatttccatgattgcggagcagttgtccatggagaaggaagtggtaagagtctggttctgcaatcgacgccaaaaggagaagagaatcaactgccctgtggccacacctgtcaagccgcccatctacaactcccggctggtctctccctcagggtctctgggctccctctcagtccctcctgtccacagcaccatgcctggaacagtaacgtcatcctgttcccctgggaacaacagcaggccctcgtctcccggctcaggactccatgccagcagccccacggcatctcaaaataactccaaagcagcaatgaacccctcctccgccgcctttaactcctcagggtcatggtaccgttggaaccatcccgcctacctccactgagaccaaaaacttcctcccgttccacctggcccctggttcccaccaggaggaagagcggccacaccttccacgtatggacagacactttgagactcggagcgggagaaatggccgctgctgaagagcaaacccacaatcttgccttctcctggatccagagcttccagagaaccaagctgtgaccaaaggccacactcttgccttgggctcttgatcaccccgctgggagtttaccgtgctcacccgtgacccgcttcatgctcacatgatggcttcacctattggagaaagggcattctgccattgttagttttcagctcaccggtgggattctgggacagccttttgctcgttgtgccaaactgcaagaagggtagattatggttttgactctgacctcagccacaatcctgaactgatccaaattctatgagaagactgaaatctcgtgtctctaccaaagccttattttgttaaattagcacagttttcttacagcatctccatttttgcccaactttcttttagcccttactcccttttctacaacaaaacctgtctatccttaggtcctacaaagtcccttcctctctacaaatggctaagctcccctctggccatgttgctccattcacgtgtactcttttgttgcccacatgttcccaagttcaagaacacttgttttttttctgttctctgtgggttttcttgtcctgtcccctctccttgctcctggccacagagaagtacacacactgtggccactttcttgtacatagtcctttcctactctgcactatgaccgttcatctttaatgtgtaatttcccagcgaaatgtttaactcaggtgtgcattttgaagatgtctctatattattttatcttctgttagaaaaggaagggggataccagagtgtggaacaccccacagagttcccacgtgagctggggttctgcagactttgtggaggaacatcgtatgtggagtctccttctgtgggtctgtgtgtaaaactgtcacatgaaagccatcccaga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]