GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 16:28:46, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001100813            3480 bp    mRNA    linear   ROD 01-FEB-2021
DEFINITION  Rattus norvegicus claudin 12 (Cldn12), mRNA.
ACCESSION   NM_001100813 XM_001067932 XM_575355
VERSION     NM_001100813.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 3480)
  AUTHORS   Castro Dias M, Coisne C, Baden P, Enzmann G, Garrett L, Becker L,
            Holter SM, Hrabe de Angelis M, Deutsch U and Engelhardt B.
  CONSRTM   German Mouse Clinic Consortium
  TITLE     Claudin-12 is not required for blood-brain barrier tight junction
            function
  JOURNAL   Fluids Barriers CNS 16 (1), 30 (2019)
   PUBMED   31511021
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 3480)
  AUTHORS   Berndt P, Winkler L, Cording J, Breitkreuz-Korff O, Rex A, Dithmer
            S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE
            and Haseloff RF.
  TITLE     Tight junction proteins at the blood-brain barrier: far more than
            claudin-5
  JOURNAL   Cell. Mol. Life Sci. 76 (10), 1987-2002 (2019)
   PUBMED   30734065
REFERENCE   3  (bases 1 to 3480)
  AUTHORS   Wang J, Chen J, Tang Z, Li Y, Hu L and Pan J.
  TITLE     The Effects of Copper on Brain Microvascular Endothelial Cells and
            Claudin Via Apoptosis and Oxidative Stress
  JOURNAL   Biol Trace Elem Res 174 (1), 132-141 (2016)
   PUBMED   27038183
  REMARK    GeneRIF: identified four claudin isoforms (1, 3, 5, and 12) and
            showed that their expression levels were regulated as a group by
            copper
REFERENCE   4  (bases 1 to 3480)
  AUTHORS   Harris HJ, Davis C, Mullins JG, Hu K, Goodall M, Farquhar MJ, Mee
            CJ, McCaffrey K, Young S, Drummer H, Balfe P and McKeating JA.
  TITLE     Claudin association with CD81 defines hepatitis C virus entry
  JOURNAL   J. Biol. Chem. 285 (27), 21092-21102 (2010)
   PUBMED   20375010
REFERENCE   5  (bases 1 to 3480)
  AUTHORS   Friedman LM, Dror AA, Mor E, Tenne T, Toren G, Satoh T, Biesemeier
            DJ, Shomron N, Fekete DM, Hornstein E and Avraham KB.
  TITLE     MicroRNAs are essential for development and function of inner ear
            hair cells in vertebrates
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 106 (19), 7915-7920 (2009)
   PUBMED   19416898
REFERENCE   6  (bases 1 to 3480)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim. Biophys. Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   7  (bases 1 to 3480)
  AUTHORS   Fujita H, Chiba H, Yokozaki H, Sakai N, Sugimoto K, Wada T, Kojima
            T, Yamashita T and Sawada N.
  TITLE     Differential expression and subcellular localization of claudin-7,
            -8, -12, -13, and -15 along the mouse intestine
  JOURNAL   J. Histochem. Cytochem. 54 (8), 933-944 (2006)
   PUBMED   16651389
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC111647.10 and BP465177.1.
            On or before Aug 9, 2007 this sequence version replaced
            XM_575355.2, XM_001067932.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BF554096.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-53                AC111647.10        103268-103320
            54-2965             AC111647.10        105998-108909
            2966-3480           BP465177.1         1-515               c
FEATURES             Location/Qualifiers
     source          1..3480
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q13"
     gene            1..3480
                     /gene="Cldn12"
                     /gene_synonym="RGD1561053"
                     /note="claudin 12"
                     /db_xref="GeneID:500000"
                     /db_xref="RGD:1561053"
     exon            1..53
                     /gene="Cldn12"
                     /gene_synonym="RGD1561053"
                     /inference="alignment:Splign:2.0.8"
     misc_feature    47..49
                     /gene="Cldn12"
                     /gene_synonym="RGD1561053"
                     /note="upstream in-frame stop codon"
     exon            54..3479
                     /gene="Cldn12"
                     /gene_synonym="RGD1561053"
                     /inference="alignment:Splign:2.0.8"
     CDS             83..817
                     /gene="Cldn12"
                     /gene_synonym="RGD1561053"
                     /codon_start=1
                     /product="claudin-12"
                     /protein_id="NP_001094283.1"
                     /db_xref="GeneID:500000"
                     /db_xref="RGD:1561053"
                     /translation="
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTIYTGLWVKCARYDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSILIAMGALLLCLIGMCNTAFKSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAIFYNSHLNKKFEPVFTFDYAVFVTIASSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHPPGMHTYSQPYSSRSRLSAIEIDIPVVSHST"
     STS             3110..3290
                     /gene="Cldn12"
                     /gene_synonym="RGD1561053"
                     /standard_name="RH130508"
                     /db_xref="UniSTS:213792"
ORIGIN      
gaatcagtggcataggacaggctgtttggagaaacactgattattttgaaattacgaaacacactgcccaagccctcctgccatgggctgccgagatgtccatgcagccacggtcctctccttcctgtgcggcattgcctctgtagcaggcctcttcgcggggactctgcttcccaactggaggaagctgcgactcatcacattcaacagaaatgagaagaacctgacgatctacacgggcctgtgggtgaagtgcgcccggtatgacggaagcagtgactgcctgatgtacgaccgcacttggtacctgtcggtcgaccagctggacctgcgcgtcctccagttcgccctgcccctcagcatcctgatcgcaatgggtgccttgctgctctgcctgattgggatgtgcaacacggccttcaagtcttcggtgcctaacatcaaactggccaagtgtctggtcaatagtgcaggctgccacctggtggctggactcctgtttttcctggcaggtaccgtgagcctctctccatccatctgggccatcttctataacagccatctcaacaagaagttcgagccggtctttacctttgactatgcagtgtttgtcacgatcgctagctcagggggtctgttcatgactgctcttctgctgtttgtttggtactgtgcatgcaagtctttgtcctctcctttctggcagccactgtactcccatcctcctgggatgcacacttactcacagccctattcatcacggtcccgcctctctgccattgaaattgacattccggtagtttcacatagcacttaacagttataattaactgctcaaagtgtgtctggtagcctcacagccccctgcataacgagcctttttggacctgtgtacatttttcctttgttccttacccatcagtggagccgcatttgtatatcttggtagaaaggaaggctgctagactttatgaggtacatggttcattcttctaaatgtgaaacattccttttatcttgcttctaagaccaagggtctttggcctccttgttgatgtctgtgatcagtcacttaggtgagagggcctgtgataacgactgaggcaatgaagacggcatactgagcaatgctgtttgatccttaccgatatttcagattgtgcatcgtctccgatgacttaaaagtgaaaggggcagtttcagatttcaggagtctcggtcagatacggctagtgcttgtcttcacactctaccagcctgaaggtataatttcgttctctcttgggactaatcgagtagggcatctgtatactgaagattagtatcttctacctcatttcagtgaaaagcagaacgtggcttaaatgatgacagagtaaggctaacatttaaacacagttaacgtttgacttctttgttggtttcacgtagggtcttgctgtgtagccctggctggcctagaactcactctgtagaccagtctggactcacacgtgaccgttctccagcttgcctcctgagcactaactaccggcatgccccactcttgtgtaacaccccgtaagttttagttactgattatatcgccggagttaaaaggctgtcaggagacagcatgtcgcttcattcaaagcaagaatccctttccagatacccttccttcaggtagtgctcatgccctgggcaagctcttagtgcctaagacaaatgaataaaaggttgttgaagccaaatggttgtcttttagacacaaatgctagggcacaggaggctgtcggtcagtgtcagcgccaaagattcatttggtggctcctatttgagttgtggctttgctctgttcagtttctgcttctaacactgcttcacacttgagcaagtgctttagaggatacacaaacaggagaagtagccatgtaggagttttgctctaacacacctgataaccagtgggaagtctgactttacggtagctggtaaacttcaggcattgactgaggaatgtgtttcacctgaaacatgtctttctgacacagccaacctacgtacaccaccagcggtagcctggactctgggaattcactttagtatgtctcctcccgtagctcacaagctgtaataacggcctcagatcatgagaatgggcgagataggagagagattaaattatacctgttctacctctgaaactaagatgagatattaaagagggataagttttaaaaatatctcttccgatgtgacgtcaaatggataaaaccatttagtactaacctcccactttgacattgagagatgttgggtcttaactattaggaatttgagctggtcactaattggtatgatgtccacttactagcgttgtgttttgtaaggattgtggaatattacagtcaagagttttttacaagcagctgattttacggtaacagtctatgatgccacctttccaaatctgagtatttctgtagaatatgtagtacttttccctaagtccaacactactactttatgtaggcaagtaaatccaattgtataatttttaaaaaccgtcagtacaaagcatgcatttctatgtgttttttgtttaaattatggcttctagtcttttccacctccgccttttctcattcataagtaaagctgagtgttggtcctgttgaagttttgagattaatactagttttcttcccttttattaactaatcttagttcttctctcactaaactgttttcagaaagattaaaaatcccgccatgccttggcgttagtataaagagataaaagcagggccaggtgtagtggcttttgactttaccaccagcactgaggaggccgagacaggtgcatctctggaaattccggtctccatggcaagttccaagccagtcagagccacacagaaagaccctgtcttaaaaacaaaattagggaaagaaaaaaaaaagtggactcagccatgaggacactagacagttttcagctcacaggattgtaactacaggcattaagctttcttatgagaattttttggcattaccatccatagcctccaattactgcttattacaaattcgctcaggaagagaaacagctgtttcagtattatctttttagtgttccagattgggcataaatagtgctttttagagccatcaaaggaaagcatgtatttacaatccttctgagtcactgccggggctgttcttcagatggggtgggtaacgtcttttgttgctaaaaagctgttggttttgaaggccttccatggagccagtgtgtcagacaaccttgaatgtgagatggcgcagcaagtctgtgtcacccacctttgggagaagagtaagcctaagatcccaagttcactctgcgtgtacatacgccctgtgatggatagcgtgtgctgtaaaccacaaggtagagacctcagtgggtgtgctgtgctgctgcctcacgtttattaaaagatgtatttttacaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]