ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-04 21:46:57, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001100566 2339 bp mRNA linear ROD 18-FEB-2025 DEFINITION Rattus norvegicus orthodenticle homeobox 2 (Otx2), transcript variant 3, mRNA. ACCESSION NM_001100566 XM_001057814 XM_001073859 XM_224009 VERSION NM_001100566.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2339) AUTHORS Rohde,K., Hertz,H. and Rath,M.F. TITLE Homeobox genes in melatonin-producing pinealocytes: Otx2 and Crx act to promote hormone synthesis in the mature rat pineal gland JOURNAL J Pineal Res 66 (4), e12567 (2019) PUBMED 30803008 REMARK GeneRIF: The results suggest that Otx2 and Crx, both alone and in combination, act to control pineal melatonin synthesis. REFERENCE 2 (bases 1 to 2339) AUTHORS Xiong,Y., Ji,H., You,Z., Yao,F., Zhou,R., Song,W. and Xia,X. TITLE Otx2 enhances transdifferentiation of Muller cells-derived retinal stem cells into photoreceptor-like cells JOURNAL J Cell Mol Med 23 (2), 943-953 (2019) PUBMED 30451368 REMARK GeneRIF: Otx2 is a potential target for gene therapy of retinal degenerative diseases. REFERENCE 3 (bases 1 to 2339) AUTHORS Kole,C., Berdugo,N., Da Silva,C., Ait-Ali,N., Millet-Puel,G., Pagan,D., Blond,F., Poidevin,L., Ripp,R., Fontaine,V., Wincker,P., Zack,D.J., Sahel,J.A., Poch,O. and Leveillard,T. TITLE Identification of an Alternative Splicing Product of the Otx2 Gene Expressed in the Neural Retina and Retinal Pigmented Epithelial Cells JOURNAL PLoS One 11 (3), e0150758 (2016) PUBMED 26985665 REMARK GeneRIF: Otx2S is a novel variant of the Otx2 gene with a deletion within the homeodomain sequence. OTX2S exerts transdominant activity on the tyrosinase promoter when tested in the physiological environment of primary retinal pigmented epithelial cells. Publication Status: Online-Only REFERENCE 4 (bases 1 to 2339) AUTHORS Costello,I., Nowotschin,S., Sun,X., Mould,A.W., Hadjantonakis,A.K., Bikoff,E.K. and Robertson,E.J. TITLE Lhx1 functions together with Otx2, Foxa2, and Ldb1 to govern anterior mesendoderm, node, and midline development JOURNAL Genes Dev 29 (20), 2108-2122 (2015) PUBMED 26494787 REFERENCE 5 (bases 1 to 2339) AUTHORS Hoch,R.V., Lindtner,S., Price,J.D. and Rubenstein,J.L. TITLE OTX2 Transcription Factor Controls Regional Patterning within the Medial Ganglionic Eminence and Regional Identity of the Septum JOURNAL Cell Rep 12 (3), 482-494 (2015) PUBMED 26166575 REFERENCE 6 (bases 1 to 2339) AUTHORS Kinder,S.J., Tsang,T.E., Ang,S.L., Behringer,R.R. and Tam,P.P. TITLE Defects of the body plan of mutant embryos lacking Lim1, Otx2 or Hnf3beta activity JOURNAL Int J Dev Biol 45 (1), 347-355 (2001) PUBMED 11291865 REFERENCE 7 (bases 1 to 2339) AUTHORS Baas,D., Bumsted,K.M., Martinez,J.A., Vaccarino,F.M., Wikler,K.C. and Barnstable,C.J. TITLE The subcellular localization of Otx2 is cell-type specific and developmentally regulated in the mouse retina JOURNAL Brain Res Mol Brain Res 78 (1-2), 26-37 (2000) PUBMED 10891582 REFERENCE 8 (bases 1 to 2339) AUTHORS Morsli,H., Tuorto,F., Choo,D., Postiglione,M.P., Simeone,A. and Wu,D.K. TITLE Otx1 and Otx2 activities are required for the normal development of the mouse inner ear JOURNAL Development 126 (11), 2335-2343 (1999) PUBMED 10225993 REFERENCE 9 (bases 1 to 2339) AUTHORS Biben,C., Stanley,E., Fabri,L., Kotecha,S., Rhinn,M., Drinkwater,C., Lah,M., Wang,C.C., Nash,A., Hilton,D., Ang,S.L., Mohun,T. and Harvey,R.P. TITLE Murine cerberus homologue mCer-1: a candidate anterior patterning molecule JOURNAL Dev Biol 194 (2), 135-151 (1998) PUBMED 9501024 REFERENCE 10 (bases 1 to 2339) AUTHORS Robel,L., Ding,M., James,A.J., Lin,X., Simeone,A., Leckman,J.F. and Vaccarino,F.M. TITLE Fibroblast growth factor 2 increases Otx2 expression in precursor cells from mammalian telencephalon JOURNAL J Neurosci 15 (12), 7879-7891 (1995) PUBMED 8613727 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CB580080.1 and JAXUCZ010000015.1. On or before Dec 18, 2009 this sequence version replaced XM_001057814.1, XM_001073859.1, XM_224009.3. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR26360176.1837840.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN13663602, SAMN13663603 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-613 CB580080.1 1-613 614-694 JAXUCZ010000015.1 24426352-24426432 c 695-2339 JAXUCZ010000015.1 24422876-24424520 c FEATURES Location/Qualifiers source 1..2339 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="15" /map="15p14" gene 1..2339 /gene="Otx2" /note="orthodenticle homeobox 2" /db_xref="GeneID:305858" /db_xref="RGD:1305705" exon 1..87 /gene="Otx2" /inference="alignment:Splign:2.1.0" exon 88..163 /gene="Otx2" /inference="alignment:Splign:2.1.0" exon 164..326 /gene="Otx2" /inference="alignment:Splign:2.1.0" misc_feature 254..256 /gene="Otx2" /note="upstream in-frame stop codon" exon 327..542 /gene="Otx2" /inference="alignment:Splign:2.1.0" CDS 446..1315 /gene="Otx2" /note="homeobox Otx2; orthodenticle homolog 2; homeobox protein OTX2-like" /codon_start=1 /product="homeobox protein OTX2" /protein_id="NP_001094036.1" /db_xref="GeneID:305858" /db_xref="RGD:1305705" /translation="
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL"
misc_feature 560..727
/gene="Otx2"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
misc_feature 902..1147
/gene="Otx2"
/note="Otx1 transcription factor; Region: TF_Otx;
pfam03529"
/db_xref="CDD:427350"
exon 543..694
/gene="Otx2"
/inference="alignment:Splign:2.1.0"
exon 695..2339
/gene="Otx2"
/inference="alignment:Splign:2.1.0"
ORIGIN
agcggaaccttcctcagctccaactcagcctccactcttattaaaaaataaaaatcgctaaaggagcgcagtcgccacatccactttgatagctggctacttggaattttgaaggataatttgatttttttttttcttttcaagcgtccaatgcggctttaaggagtgcggctccaccaacccgggaactgcacactgaggtcggggctcctggtccagatcacccggccgaggccgctagttggacaggttttaaaggcgactctgcctagtgtggttcaggggacgcgcgccccagcctccgcgcgcacctggagcggccagagttccgtcactccaaatccacccaccaaggaccctgaccctgtccactccaggcgaatcgagaccgtccggctgggtccccccaatttgggccgactttgcgcctccaaacaaccttagcatgatgtcttatctaaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcgggtatggacttgctgcatccctccgtgggctacccggccactccccggaaacagcggagggagaggactactttcacgagggcacaacttgacgttctggaagctctgtttgccaagacccggtacccagacatcttcatgcgggaggaggtagcactgaaaatcaacttgccagagtccagggtgcaggtatggtttaagaatcgaagagctaagtgccgtcagcaacagcagcagcaacagaacggaggtcagaacaaagtgagacctgccaaaaagaagacctccccagctcgggaagtgagttcagagagtggaacaagtggccagttcactcccccctctagtacctcagtcccaaccattgccagcagcagtgctccagtgtctatctggagcccggcctccatctccccactgtctgaccccttgtccacctcctcctcctgcatgcagaggtcctaccccatgacctatactcaggcttcaggttatagtcaaggctatgctggctcgacttcctactttgggggcatggactgtggatcttacttgacccctatgcatcaccagcttcctggaccaggggccacactcagtcccatgggtaccaatgctgttaccagccacctcaatcagtccccagcttctctttccacccagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataaggaccaaactgcctcttggaagcttaacttcaatgctgactgcttggattataaggatcagacatcctcatggaaattccaggttttgtgaagacccgtaggagctattttttctttttttgtgggtgatttttaaatatgctgggctggacattccagttttagccaggcattggttaaaagagttagatgggatgatgctctcagactcctggtcaaagttaccgagaggcatagaaggaaaaaggaagggccttagaagggtccatcaaccagcaacctgagatggataaactaatctacttaagattctgttatagttctagatcattggtttttctgatttgcaaatgattgatccaaatatattctagcaacacgcaaccaaacaccactccaagcgaaaatcaaacacaactgagtaggggagggaaggtcatggccttcaaagcaggcgtgatctgatgttttagccaatctttggttgactcttaggaatggacaatgtcccaagctcattcacgtttcatgaccaactggtagttggcactgaaaaccttttcagggctgtgtgaattgtgcgactgattgtcctagatgcactactttatttaaaagaaaaaaaaaaaaagctgacgctcatacggagtcaatatgtagtttaagagacaatcagtgtgtgtcttatataaatggtacatctgtggtttttaatctgtgctagacttcaaaactgtgatctcctgttattgtatgcaaccttgaactccacctccacaggggttcttctgtgattaaataggttataattataagcaaaaattcagagcaactgaatactgatctagaacgatttacctttggctggaggtgagctgccctgctgtctctggacaaggatcgagaagaagcaaaaggagcctaattcgcccgtaatttaacgttggtaagcctggcagtcaaaaagacattggtcaattgctctgaccctgatgaattttaaactgagatcattgtcatttatgcttgcagatgttaactggaagttatatatgcataaacccttcctggatttggctgatatgtataattatattaaaatggttctagcacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]