2025-07-02 10:32:38, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001100531 2757 bp mRNA linear ROD 04-FEB-2024 DEFINITION Rattus norvegicus distal-less homeobox 1 (Dlx1), mRNA. ACCESSION NM_001100531 XM_001059233 XM_230987 VERSION NM_001100531.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2757) AUTHORS Bokenkamp,R., van Brempt,R., van Munsteren,J.C., van den Wijngaert,I., de Hoogt,R., Finos,L., Goeman,J., Groot,A.C., Poelmann,R.E., Blom,N.A. and DeRuiter,M.C. TITLE Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes identified by transcriptional profiling of laser-capture microdissected endothelial and smooth muscle cells JOURNAL PLoS One 9 (1), e86892 (2014) PUBMED 24489801 REMARK GeneRIF: Rgs5 and Dlx1 represent novel molecular targets for the regulation of ductus arteriosus maturation and closure. Publication Status: Online-Only REFERENCE 2 (bases 1 to 2757) AUTHORS Wang,B., Long,J.E., Flandin,P., Pla,R., Waclaw,R.R., Campbell,K. and Rubenstein,J.L. TITLE Loss of Gsx1 and Gsx2 function rescues distinct phenotypes in Dlx1/2 mutants JOURNAL J Comp Neurol 521 (7), 1561-1584 (2013) PUBMED 23042297 REFERENCE 3 (bases 1 to 2757) AUTHORS Delogu,A., Sellers,K., Zagoraiou,L., Bocianowska-Zbrog,A., Mandal,S., Guimera,J., Rubenstein,J.L., Sugden,D., Jessell,T. and Lumsden,A. TITLE Subcortical visual shell nuclei targeted by ipRGCs develop from a Sox14+-GABAergic progenitor and require Sox14 to regulate daily activity rhythms JOURNAL Neuron 75 (4), 648-662 (2012) PUBMED 22920256 REFERENCE 4 (bases 1 to 2757) AUTHORS Feng,L., Eisenstat,D.D., Chiba,S., Ishizaki,Y., Gan,L. and Shibasaki,K. TITLE Brn-3b inhibits generation of amacrine cells by binding to and negatively regulating DLX1/2 in developing retina JOURNAL Neuroscience 195, 9-20 (2011) PUBMED 21875655 REFERENCE 5 (bases 1 to 2757) AUTHORS Petryniak,M.A., Potter,G.B., Rowitch,D.H. and Rubenstein,J.L. TITLE Dlx1 and Dlx2 control neuronal versus oligodendroglial cell fate acquisition in the developing forebrain JOURNAL Neuron 55 (3), 417-433 (2007) PUBMED 17678855 REFERENCE 6 (bases 1 to 2757) AUTHORS Pleasure,S.J., Anderson,S., Hevner,R., Bagri,A., Marin,O., Lowenstein,D.H. and Rubenstein,J.L. TITLE Cell migration from the ganglionic eminences is required for the development of hippocampal GABAergic interneurons JOURNAL Neuron 28 (3), 727-740 (2000) PUBMED 11163262 REFERENCE 7 (bases 1 to 2757) AUTHORS Eisenstat,D.D., Liu,J.K., Mione,M., Zhong,W., Yu,G., Anderson,S.A., Ghattas,I., Puelles,L. and Rubenstein,J.L. TITLE DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal forebrain differentiation JOURNAL J Comp Neurol 414 (2), 217-237 (1999) PUBMED 10516593 REFERENCE 8 (bases 1 to 2757) AUTHORS Liu,J.K., Ghattas,I., Liu,S., Chen,S. and Rubenstein,J.L. TITLE Dlx genes encode DNA-binding proteins that are expressed in an overlapping and sequential pattern during basal ganglia differentiation JOURNAL Dev Dyn 210 (4), 498-512 (1997) PUBMED 9415433 REFERENCE 9 (bases 1 to 2757) AUTHORS Qiu,M., Bulfone,A., Ghattas,I., Meneses,J.J., Christensen,L., Sharpe,P.T., Presley,R., Pedersen,R.A. and Rubenstein,J.L. TITLE Role of the Dlx homeobox genes in proximodistal patterning of the branchial arches: mutations of Dlx-1, Dlx-2, and Dlx-1 and -2 alter morphogenesis of proximal skeletal and soft tissue structures derived from the first and second arches JOURNAL Dev Biol 185 (2), 165-184 (1997) PUBMED 9187081 REFERENCE 10 (bases 1 to 2757) AUTHORS Robel,L., Ding,M., James,A.J., Lin,X., Simeone,A., Leckman,J.F. and Vaccarino,F.M. TITLE Fibroblast growth factor 2 increases Otx2 expression in precursor cells from mammalian telencephalon JOURNAL J Neurosci 15 (12), 7879-7891 (1995) PUBMED 8613727 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473949.1. On or before Oct 24, 2008 this sequence version replaced XM_001059233.1, XM_230987.4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA5760393, SAMEA5760396 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..2757 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="3" /map="3q23" gene 1..2757 /gene="Dlx1" /note="distal-less homeobox 1" /db_xref="GeneID:296500" /db_xref="RGD:1309593" exon 1..862 /gene="Dlx1" /inference="alignment:Splign:2.1.0" misc_feature 457..459 /gene="Dlx1" /note="upstream in-frame stop codon" CDS 550..1317 /gene="Dlx1" /note="homeobox Dlx1" /codon_start=1 /product="homeobox protein DLX-1" /protein_id="NP_001094001.1" /db_xref="GeneID:296500" /db_xref="RGD:1309593" /translation="
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM"
misc_feature 934..1104 /gene="Dlx1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 863..1062 /gene="Dlx1" /inference="alignment:Splign:2.1.0" exon 1063..2757 /gene="Dlx1" /inference="alignment:Splign:2.1.0" ORIGIN
caggcgttgggggcgggcgaagggtggggacagcaagggggagggcgacggcagggcgcggctggttggtttctggggcgggaagcgcgcgagggaggcgggaggctggagtcgcgcgccttcgaggtcccagcgcggacgccgcagcccattgtgcgtcccgttccgcgcgctctgttgcagaggagccccggccgggacgtgtggacccgactctccccaggcccggccgcgtcgcccgctctagtccagcagagccggagcttctcggaccaatccccggtgattatgcaagagagccgaccaatcagctccaccagctcatgaatatttatgaccttggctgagtcaaagctttgaaccgagtttggggagctcggcagcatcatgcttagacttttcaaagagacaaactccattttcttatgaatggaaagtgaaaacccctgttccgcttaaattgggttccttcctgtcctgagaaacatagagacccccaaaagggaagcagaggagaaaaagacccacacccagaccccgcgagaagagatgaccatgaccaccatgccagaaagtctcaacagcccggtgtcgggcaaggctgtgtttatggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactactccatgcactgtttacactcggcgggccattcgcagcccgacggtgcctacagttcggcctcatccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcgtccagcccctacatcagttccgtgcagtcctaccccggcagcgccagcctcgcccagagccgcctggaggacccaggggcggactccgagaagagcaccgtggtggaaggcggagaagtgcgctttaacggcaaagggaaaaagatccgtaaacccaggacaatttattccagtttgcagttgcaggctttgaaccggaggttccaacaaactcagtacctagctctgcctgagagggcggagctggcggcctccttgggactcacacagactcaggtcaagatatggttccagaacaaacgctccaagttcaagaagctgatgaagcaaggcggggcagctctggagggcagcgcgctggcgaatggcagggccttgtctgccggctccccaccggtaccacccggctggaatccgaattcctcctctgggaagggctccggcagcagcgctggctcctacgtccccagctacacgtcgtggtatccctcagcgcaccaagaagctatgcagcagcctcaactgatgtgaggttatcagttcgcactcacccgcttcctgcccatctcccttggcccggcccctcccgcctccaggttcatccactcattcgcacgccctgggccggaaggagaagggcccaagggcgagggcgggggacgtaaaaataaaagaaaaaggaacagtgaaggcttgctgcctcctcggagcccctaaaaatctggcccagcgacttttcagctctgggcttgaacctggtttgggccacggtgacagcagagtgacctcaaagcgcaggcacaaccactggagacagccagtgcaacaagacaagccgctggacccgaccagactctcagctttgtgagactatcaggaaaaaaaaattacgtaggagggggaaatatgctcttttttcggttctgtccgtctttgtctcctttttgcaccgtctgtgcgccgaagtcaaggtcctcgtgtgtctgctgtcctctccaaaaagtcaccagatctgagccacactggtctgccggcagcccatcacgaaccctggaacgctttttttctgaatggtcttcttccgggccctgcttcaccatctgtgtagcttgtttgggcaatggggggaatcggagggaggggggttaatttattgaaaaacagacgctgagtgttggccaattccaagttctctgagacatggagtgggcactgtccaaacacactatttaccttaaacacaccagaagagggaacaaggatgggatggtggctttttaaggtacctggtaacttttgtactttgttggaatggagaagtggaggcagagtgatttgcattttacacgacccacatgattaaaaaataacaaaagaaatagtgaagtaaggaaagatatgtcaagccaacagaatgttgtcaaaaacgtttggacaagaacacccggccaagaagaaaaagcatactttgggcagcaagagagaggaccaagtgggttttggagagaaaataatttgtcctgtgaaagcaccccaattccaggtcgcttgaaagtcagacacaagcagctttaaatgatccccagtggctcgaccacagaacacaagtcatcaccctgaacgcacagcctctggtgcaggacctaatcgttgtacatattattattgttattgttgttattaattattattattgttctgtaaacacgttgcacaagcttagcctctttccgttccgtcgtgtgtggctgtaaaccccaatgctttgtgaaaatgagaatcttgacattttacttgtgaaatttggaaaatgtgaccgattgaaatcaaccgtgttttgtgttctctatgtcaaagtttagttttatattgagaatgttaacttattgctttgtatctcggggagtgggggaactttgtaaataagttataaagtttctttgagacagtaaaattatggtttcaagaaag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]