GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-02 10:32:38, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001100531            2757 bp    mRNA    linear   ROD 04-FEB-2024
DEFINITION  Rattus norvegicus distal-less homeobox 1 (Dlx1), mRNA.
ACCESSION   NM_001100531 XM_001059233 XM_230987
VERSION     NM_001100531.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2757)
  AUTHORS   Bokenkamp,R., van Brempt,R., van Munsteren,J.C., van den
            Wijngaert,I., de Hoogt,R., Finos,L., Goeman,J., Groot,A.C.,
            Poelmann,R.E., Blom,N.A. and DeRuiter,M.C.
  TITLE     Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes
            identified by transcriptional profiling of laser-capture
            microdissected endothelial and smooth muscle cells
  JOURNAL   PLoS One 9 (1), e86892 (2014)
   PUBMED   24489801
  REMARK    GeneRIF: Rgs5 and Dlx1 represent novel molecular targets for the
            regulation of ductus arteriosus maturation and closure.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2757)
  AUTHORS   Wang,B., Long,J.E., Flandin,P., Pla,R., Waclaw,R.R., Campbell,K.
            and Rubenstein,J.L.
  TITLE     Loss of Gsx1 and Gsx2 function rescues distinct phenotypes in
            Dlx1/2 mutants
  JOURNAL   J Comp Neurol 521 (7), 1561-1584 (2013)
   PUBMED   23042297
REFERENCE   3  (bases 1 to 2757)
  AUTHORS   Delogu,A., Sellers,K., Zagoraiou,L., Bocianowska-Zbrog,A.,
            Mandal,S., Guimera,J., Rubenstein,J.L., Sugden,D., Jessell,T. and
            Lumsden,A.
  TITLE     Subcortical visual shell nuclei targeted by ipRGCs develop from a
            Sox14+-GABAergic progenitor and require Sox14 to regulate daily
            activity rhythms
  JOURNAL   Neuron 75 (4), 648-662 (2012)
   PUBMED   22920256
REFERENCE   4  (bases 1 to 2757)
  AUTHORS   Feng,L., Eisenstat,D.D., Chiba,S., Ishizaki,Y., Gan,L. and
            Shibasaki,K.
  TITLE     Brn-3b inhibits generation of amacrine cells by binding to and
            negatively regulating DLX1/2 in developing retina
  JOURNAL   Neuroscience 195, 9-20 (2011)
   PUBMED   21875655
REFERENCE   5  (bases 1 to 2757)
  AUTHORS   Petryniak,M.A., Potter,G.B., Rowitch,D.H. and Rubenstein,J.L.
  TITLE     Dlx1 and Dlx2 control neuronal versus oligodendroglial cell fate
            acquisition in the developing forebrain
  JOURNAL   Neuron 55 (3), 417-433 (2007)
   PUBMED   17678855
REFERENCE   6  (bases 1 to 2757)
  AUTHORS   Pleasure,S.J., Anderson,S., Hevner,R., Bagri,A., Marin,O.,
            Lowenstein,D.H. and Rubenstein,J.L.
  TITLE     Cell migration from the ganglionic eminences is required for the
            development of hippocampal GABAergic interneurons
  JOURNAL   Neuron 28 (3), 727-740 (2000)
   PUBMED   11163262
REFERENCE   7  (bases 1 to 2757)
  AUTHORS   Eisenstat,D.D., Liu,J.K., Mione,M., Zhong,W., Yu,G., Anderson,S.A.,
            Ghattas,I., Puelles,L. and Rubenstein,J.L.
  TITLE     DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal
            forebrain differentiation
  JOURNAL   J Comp Neurol 414 (2), 217-237 (1999)
   PUBMED   10516593
REFERENCE   8  (bases 1 to 2757)
  AUTHORS   Liu,J.K., Ghattas,I., Liu,S., Chen,S. and Rubenstein,J.L.
  TITLE     Dlx genes encode DNA-binding proteins that are expressed in an
            overlapping and sequential pattern during basal ganglia
            differentiation
  JOURNAL   Dev Dyn 210 (4), 498-512 (1997)
   PUBMED   9415433
REFERENCE   9  (bases 1 to 2757)
  AUTHORS   Qiu,M., Bulfone,A., Ghattas,I., Meneses,J.J., Christensen,L.,
            Sharpe,P.T., Presley,R., Pedersen,R.A. and Rubenstein,J.L.
  TITLE     Role of the Dlx homeobox genes in proximodistal patterning of the
            branchial arches: mutations of Dlx-1, Dlx-2, and Dlx-1 and -2 alter
            morphogenesis of proximal skeletal and soft tissue structures
            derived from the first and second arches
  JOURNAL   Dev Biol 185 (2), 165-184 (1997)
   PUBMED   9187081
REFERENCE   10 (bases 1 to 2757)
  AUTHORS   Robel,L., Ding,M., James,A.J., Lin,X., Simeone,A., Leckman,J.F. and
            Vaccarino,F.M.
  TITLE     Fibroblast growth factor 2 increases Otx2 expression in precursor
            cells from mammalian telencephalon
  JOURNAL   J Neurosci 15 (12), 7879-7891 (1995)
   PUBMED   8613727
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473949.1.
            
            On or before Oct 24, 2008 this sequence version replaced
            XM_001059233.1, XM_230987.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760393,
                              SAMEA5760396 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2757
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /map="3q23"
     gene            1..2757
                     /gene="Dlx1"
                     /note="distal-less homeobox 1"
                     /db_xref="GeneID:296500"
                     /db_xref="RGD:1309593"
     exon            1..862
                     /gene="Dlx1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    457..459
                     /gene="Dlx1"
                     /note="upstream in-frame stop codon"
     CDS             550..1317
                     /gene="Dlx1"
                     /note="homeobox Dlx1"
                     /codon_start=1
                     /product="homeobox protein DLX-1"
                     /protein_id="NP_001094001.1"
                     /db_xref="GeneID:296500"
                     /db_xref="RGD:1309593"
                     /translation="
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM"
     misc_feature    934..1104
                     /gene="Dlx1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            863..1062
                     /gene="Dlx1"
                     /inference="alignment:Splign:2.1.0"
     exon            1063..2757
                     /gene="Dlx1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
caggcgttgggggcgggcgaagggtggggacagcaagggggagggcgacggcagggcgcggctggttggtttctggggcgggaagcgcgcgagggaggcgggaggctggagtcgcgcgccttcgaggtcccagcgcggacgccgcagcccattgtgcgtcccgttccgcgcgctctgttgcagaggagccccggccgggacgtgtggacccgactctccccaggcccggccgcgtcgcccgctctagtccagcagagccggagcttctcggaccaatccccggtgattatgcaagagagccgaccaatcagctccaccagctcatgaatatttatgaccttggctgagtcaaagctttgaaccgagtttggggagctcggcagcatcatgcttagacttttcaaagagacaaactccattttcttatgaatggaaagtgaaaacccctgttccgcttaaattgggttccttcctgtcctgagaaacatagagacccccaaaagggaagcagaggagaaaaagacccacacccagaccccgcgagaagagatgaccatgaccaccatgccagaaagtctcaacagcccggtgtcgggcaaggctgtgtttatggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactactccatgcactgtttacactcggcgggccattcgcagcccgacggtgcctacagttcggcctcatccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcgtccagcccctacatcagttccgtgcagtcctaccccggcagcgccagcctcgcccagagccgcctggaggacccaggggcggactccgagaagagcaccgtggtggaaggcggagaagtgcgctttaacggcaaagggaaaaagatccgtaaacccaggacaatttattccagtttgcagttgcaggctttgaaccggaggttccaacaaactcagtacctagctctgcctgagagggcggagctggcggcctccttgggactcacacagactcaggtcaagatatggttccagaacaaacgctccaagttcaagaagctgatgaagcaaggcggggcagctctggagggcagcgcgctggcgaatggcagggccttgtctgccggctccccaccggtaccacccggctggaatccgaattcctcctctgggaagggctccggcagcagcgctggctcctacgtccccagctacacgtcgtggtatccctcagcgcaccaagaagctatgcagcagcctcaactgatgtgaggttatcagttcgcactcacccgcttcctgcccatctcccttggcccggcccctcccgcctccaggttcatccactcattcgcacgccctgggccggaaggagaagggcccaagggcgagggcgggggacgtaaaaataaaagaaaaaggaacagtgaaggcttgctgcctcctcggagcccctaaaaatctggcccagcgacttttcagctctgggcttgaacctggtttgggccacggtgacagcagagtgacctcaaagcgcaggcacaaccactggagacagccagtgcaacaagacaagccgctggacccgaccagactctcagctttgtgagactatcaggaaaaaaaaattacgtaggagggggaaatatgctcttttttcggttctgtccgtctttgtctcctttttgcaccgtctgtgcgccgaagtcaaggtcctcgtgtgtctgctgtcctctccaaaaagtcaccagatctgagccacactggtctgccggcagcccatcacgaaccctggaacgctttttttctgaatggtcttcttccgggccctgcttcaccatctgtgtagcttgtttgggcaatggggggaatcggagggaggggggttaatttattgaaaaacagacgctgagtgttggccaattccaagttctctgagacatggagtgggcactgtccaaacacactatttaccttaaacacaccagaagagggaacaaggatgggatggtggctttttaaggtacctggtaacttttgtactttgttggaatggagaagtggaggcagagtgatttgcattttacacgacccacatgattaaaaaataacaaaagaaatagtgaagtaaggaaagatatgtcaagccaacagaatgttgtcaaaaacgtttggacaagaacacccggccaagaagaaaaagcatactttgggcagcaagagagaggaccaagtgggttttggagagaaaataatttgtcctgtgaaagcaccccaattccaggtcgcttgaaagtcagacacaagcagctttaaatgatccccagtggctcgaccacagaacacaagtcatcaccctgaacgcacagcctctggtgcaggacctaatcgttgtacatattattattgttattgttgttattaattattattattgttctgtaaacacgttgcacaagcttagcctctttccgttccgtcgtgtgtggctgtaaaccccaatgctttgtgaaaatgagaatcttgacattttacttgtgaaatttggaaaatgtgaccgattgaaatcaaccgtgttttgtgttctctatgtcaaagtttagttttatattgagaatgttaacttattgctttgtatctcggggagtgggggaactttgtaaataagttataaagtttctttgagacagtaaaattatggtttcaagaaag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]