GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2018-06-23 22:45:43, GGRNA.v2 : RefSeq release 88 (May, 2018)

LOCUS       NM_001094526            1995 bp    mRNA    linear   VRT 29-OCT-2016
DEFINITION  Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA.
ACCESSION   NM_001094526
VERSION     NM_001094526.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 1995)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PREDICTED REFSEQ: This record has not been reviewed and the
            function is unknown. The reference sequence was derived from
            BC082674.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC082674.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00012419, SAMN03766241
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1995
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="7L"
     gene            1..1995
                     /gene="cldn19.L"
                     /gene_synonym="claudin-19"
                     /note="claudin 19 L homeolog"
                     /db_xref="GeneID:494684"
                     /db_xref="Xenbase:XB-GENE-17346338"
     misc_feature    149..151
                     /gene="cldn19.L"
                     /gene_synonym="claudin-19"
                     /note="upstream in-frame stop codon"
     CDS             248..880
                     /gene="cldn19.L"
                     /gene_synonym="claudin-19"
                     /codon_start=1
                     /product="uncharacterized protein LOC494684"
                     /protein_id="NP_001087995.1"
                     /db_xref="GeneID:494684"
                     /db_xref="Xenbase:XB-GENE-17346338"
                     /translation="
MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV"
     misc_feature    257..793
                     /gene="cldn19.L"
                     /gene_synonym="claudin-19"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
ORIGIN      
attgatgtgtgaatatgaagttctcagcaccaaattgtgtcttgcaggtaccaccaggaagaacgctctaatctgttgatacagcgcctgaccatctttgtagcatccctcagcagggaaagtgcactgcaatctactgagcagaacttagttgacccacgtctgtcttccacatcttctgaatccaagtggatcccttttcccttcttggaaacacaaggtcaaggttaacaaaaaaaaacaaactatggcaaattcaggattccagctgcttgggtattttcttgcattaggaggttggattggcattatatctacaacagcattgccccagtggaagcaatcatcctatgcaggggatgccattatcacagcagtgggactgtatgagggactctggatgtcatgcgcttctcagagcactgggcaggtgcaatgtaaagtctacgactctctgctttccctggaggttcacatccagacaacacgggctctcatggtggtcgccatgctcctgggattcgttggtattataatcagtgtggttggaatgaaatgtactaaagtcggtgataacaaccctattacaaaaagcagaattgctgtctctgggggagtccttttcctgctagcaggtctttgtaccttaataggagtttcatggtacgcaacacaagtcactcatgacttcttcaatcccaacactccagtgaatgcgagatatgaatttggctcagcactatttgttggctgggcctctgccagcctgacaatgttggggggatctttcctgtgttgttcctgccccaacgaggatagaagaggacagcagtattacagacagtcgcagccttcagctacaaccagagagtacgtctagctcgcagcccatccctaaacattctaatcattgtcatctgcatgtgtttggaataagccaatgtgctattatttgggagtttttgtttttttattcaataaagaacggctcattaaccaattaacatgtctggagcaggtcaaaatattaactggagatgatcataaattgcctaaaaaccatgtagcataggttgttctaatgatgtctcaatgttgttatgtttttaatatgtcttgtaaacaatccttttttaactcaggggtttcaattttggttctatgtaaggcactgtcatatgctgatgggacaaggtgattaaactggcctgcgctgaggggaatgtggttctcctatgtcatagatttgtgactcctaaagactcacagaacagaaatgctacatcctcttaatcattgtagcaaatggaagaaagctgagtagtacaacgattgtcttttgcaagcaaaatgcaaacatccatcaacaaggccaaaggtctatcagtttatgcacatcttatagatacttttttttagatatgactccattttcccaaacattttgcataaatctccctatagtttcatttaaaaacgaagagaatttcgagcccatcatggcccatcaaggacgcagcttaaaccaccaaactatgcactccataacaactttttatgccaacttcttaaaaagtttattgtagggatgtttgggagctctaccacttttcctaactacaattagaaccctatactatatgtaccagccactggaatccctactagacaatatatctacatggggattatcccagtcttccttctgtgatgtctcatggcacgacatagagttggtggatccagtgtaatgtgttagcccccaatactggaacgagtttgcataaaactggggaaataaaatatactaatctaaagtttgttatgggtctatgggtttctagatgtggacaaactttaggccttttattgcattgctctaatatttatttttgtatccttcatttgtttgtgtgcatttttcttgtttttctagtcctgcaataaataaacctctgtagagttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]