GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-01-24 05:52:21, GGRNA.v2 : RefSeq release 203 (Nov, 2020)

LOCUS       NM_001093931            2908 bp    mRNA    linear   VRT 24-JUN-2020
DEFINITION  Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA.
ACCESSION   NM_001093931
VERSION     NM_001093931.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 2908)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC079722.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC079722.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2908
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="2L"
     gene            1..2908
                     /gene="cldn3.L"
                     /gene_synonym="claudin-3; cldn3"
                     /note="claudin 3 L homeolog"
                     /db_xref="GeneID:447224"
                     /db_xref="Xenbase:XB-GENE-6078310"
     exon            1..2894
                     /gene="cldn3.L"
                     /gene_synonym="claudin-3; cldn3"
                     /inference="alignment:Splign:2.0.8"
     misc_feature    355..357
                     /gene="cldn3.L"
                     /gene_synonym="claudin-3; cldn3"
                     /note="upstream in-frame stop codon"
     CDS             376..1017
                     /gene="cldn3.L"
                     /gene_synonym="claudin-3; cldn3"
                     /codon_start=1
                     /product="claudin 3 L homeolog"
                     /protein_id="NP_001087400.1"
                     /db_xref="GeneID:447224"
                     /db_xref="Xenbase:XB-GENE-6078310"
                     /translation="
MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV"
     misc_feature    382..915
                     /gene="cldn3.L"
                     /gene_synonym="claudin-3; cldn3"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
ORIGIN      
cagacaagaggaacccgcccgtctatttacctgaaagacactctctactgggcagcctgggctctcatccaagcagagcagtcagccagatacagggctgaacaagtcattgcactagtacagaagaaacaagcaaggagaaaaagtctcaaacatacaaaggaaatagaaccaccagcaactctgcagctggagacaagggtcaaatcaatatatttcaacagagacttcgctacaaagggtaccttccagacaggctcaacagattgctaaagaccaactaaagacaggcgtttctaaaggaaagcagctgtttctctgaggattatatcctggtcaacctccccatcgtcttgacatctcttacttgtcaacatgtctatgggactagagattctaggtgtggcgctatctatcgtcggatggataggaagtgtggtatgctgcgctttacctatgtggagagtaactgccttcattggaaacaacattgtcgttgcccaaactatttgggaaggactgtggatgaactgtgtggtgcagagcacggggcaaatgcaatgcaaagtgtatgactcgctattagctcttcctcaagatcttcaggcagctcgcgccctgattgtgatctcaattgtaattgctgtgctgggagttctcatttcaatcattggtgctaagtgcacaaattgtgttcaggatgagtcagctaaagccaaaattatgattgtgtctggagttatttttatccttgctggactgatgacacttatccctgtgtcctggtctgcaaacactataatccgtgatttctacaatcctttggtagtggatgcacaaaagagagagcttggctcctcaatgtaccttggatgggcagcctctgctcttcttatgcttggaggagcaatgctctgctgttcttgccccccaaaagacaagtaccctccttcaagagtggcttatacagctgccaggtcaacaaatcctggttatgacaaaaaagactacgtctgaaatggagattatgaaggactgcaggactgccttgtgacaaccaaaagggagcaaaaggaagacgttaccccctctatagacatttacaattattcatctaggaacggcatttgtcgatatttgttatatatgtgctatatattatatttagatttattgccccttttgactgcacagtttgcatttgttgtgttaagtgtctgaatgtgcacagatatattgatgttttccattgccgtggcatttgtagaatattcctgaacagggaggggcatttggtggcagagatgaggtggctgtacttcattaaccatttccataaaagcaactaactcttctgtctaaatacaaagcaaatatgctaaactgctctgtcccaatggatactggacacttccctaaccacacaatattgttgattaatagggttgtcaccctttctggaaaaaaataccggtcttcctatattctcgacgttttttataacattggcatcaagcatcatttttaccggccagacccgtaaaataccggccaggtggcaaccctattgatgaatgcaatgttatatatttggtatacctcatactctactgaattcatacttaatttcccatttgaatcaattttgtttctaggagtgtttgatggtctatattttattctctttttccacaatagagataatgtatcctaaaataacagtgtgccttctgtttcttgtctgtttgttctttctttgtactctgctcttactcctcctcctcctattccctttctcactgtaggttacatgtcaggctggaatttgacccatttcctctctattttagctgctgattgtatggtgaggcaatgttaccttctcattatcttggatttgaaacacaacccatcccttgataagctttatgtacataatcctgcagagtagggtcaaactacctgtttttttaggagttactttgagcttgagagtggcatattaacagtgttcttgttaatgtataacagcccagatatatcacttctctctcacagtactttccatgttagatatggcactggaattttagctcttccctaactaccctgatttttaatgtccatttttaattaccatgttctttgatataatttcagtaactcagtcaattatgtatttctaatgaggatcaagtaatcaatgctctaattaagttaacagtcacagcaacattattatttgagtgggaaggtcaggaggccattctaatctagtatttgccaagaactatgagtcccatggccgttaactggctatggaacatggaacagatggaatgttgtaggctccctaccccagagatacaatttttttgtattttaacagtggaggcacattaactgtacagaaatatgcatataaatatatatatagatggatatatgtttatatatactatacacacatatgtataaatgtataggtccacaatttttagtagctctgtttttattttctgtttatattttcatcaactaatcaacaatcacagaaacattttacagtttggatgagacgctgaacagcatttctaacgctaaacaataatttgtacgatttgtattccttttattaataccactgttatatatgaaccattttttttatcagttagtgaacaggtaaatattaaatgttctagttgtatgacccagtatctaggagttcatcgtattcatgctagtgatggtgtatgaagaaatgtattgtgttaataaagaattatacttgggtttgtacactaagtaatgtagacacatatcattattgtcaactgtatatattaaaataccttttgactgaaactatattaaacacttcctataaatcaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]