GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:29:24, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001089974            2388 bp    mRNA    linear   VRT 02-MAR-2017
DEFINITION  Xenopus laevis claudin 18 L homeolog (cldn18.L), mRNA.
ACCESSION   NM_001089974 NM_001089975
VERSION     NM_001089974.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 2388)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC060425.1.
            On Jul 25, 2007 this sequence version replaced NM_001089975.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC060425.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2388
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="5L"
     gene            1..2388
                     /gene="cldn18.L"
                     /gene_synonym="claudin-18; cldn18"
                     /note="claudin 18 L homeolog"
                     /db_xref="GeneID:398928"
                     /db_xref="Xenbase:XB-GENE-991174"
     CDS             84..866
                     /gene="cldn18.L"
                     /gene_synonym="claudin-18; cldn18"
                     /codon_start=1
                     /product="claudin 18 L homeolog"
                     /protein_id="NP_001083443.1"
                     /db_xref="GeneID:398928"
                     /db_xref="Xenbase:XB-GENE-991174"
                     /translation="
MSVTMCQTMGFLVSALGFAGIIAATALDPWSTQDLYDNPVTAVFQYQGLWKSCVQQSSGFTECRPYYTILGLPAMFQAVRALMIVGIVLGAIGLLVAIFSLKCIRIGNMEDSAKANITLTSGIMFILAGLCSIIGVSVFANMLITNFWMTTANMYTGGAISGMGGMGGLQTLQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLMPEESNYKAVSYHVSTKTPGYKTSAYEDKSKKSIYNESRRSEDGKSYPSKYDYV"
     misc_feature    102..677
                     /gene="cldn18.L"
                     /gene_synonym="claudin-18; cldn18"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     misc_feature    102..677
                     /gene="cldn18.L"
                     /gene_synonym="claudin-18; cldn18"
                     /note="PMP22_Claudin; Region: PMP-22/EMP/MP20/Claudin
                     family"
ORIGIN      
gtgatagctgtccttgtgaatggtactcctgtaagtcaaaagaaggaaggaaattgtgcttggacactacacaactcgccaccatgtcggtaacaatgtgtcaaaccatgggctttcttgtatcagccctgggctttgctgggattatagcagcaactgctttggatccatggagcacgcaagatttatacgataatccagttactgctgtgttccagtaccagggactctggaagagttgtgtccaacagagttccggattcaccgagtgtcgaccctactacactatccttgggttaccagctatgttccaggcagtcagagccctgatgattgtgggcatagtgttgggagccattggcttacttgtggccattttttccctgaagtgtattcgcattggtaacatggaggattctgccaaggccaacattaccttgacatctggtatcatgttcattctggcaggactctgttcaataatcggagtatctgtctttgccaacatgttgattacaaacttctggatgactacagctaatatgtacacaggtggtgctatcagtggaatgggaggaatgggcggattgcagactctacaaacaagatatacttttggggcagccctttttgttggatgggtcgctggaggcttgacgttgattggaggtgttatgatgtgcatagcatgccgtggactcatgccagaagaaagcaactacaaggcagtttcctaccatgtttccacaaaaaccccaggctacaagacatccgcctacgaggataagagtaaaaaatccatttacaacgaatccagacgcagcgaggatgggaagagctacccttcaaaatatgattatgtgtagccgcttaagtacctggcatctacctacagttatatacagttgtactgtttattataaggggatggctgtattaatcagtgcaacccatcaagataatttattgctaatcagcaacatggtacagctaatgagtaagtttgttaacctgcatctcatggctaagcactgtttattaagccaaatcctttttttttttttttgttttatagtatattttaaaatgatttttacataaatctgtttgtatctatacacttatagtttagcttatagttatgtttatagttaaagttgctttttaaagatataatagccaaacatttctaaaaatgtaaccaagggactacaaccgaaccctgtgctgctgctctattggtttccaggccgatacaaggttctgtctgtgttttgggctgggaacatttttcttgagcagtgcctcctctttgggcaggcccttggagattaaactgctgatgtatttctatgataaggattagttacacatggacaggacctttctaaaatggcctcttagatgttacctacaaagtagtgcagtaagccaaagcaaccataagtctatatatactaggtaattgttgctggttcctagagaccattgcaatgatccaaaattgtacttatatcagtatatatatatatatatatatatatatatatagacctccacgcatagatatgttgagctttgtttatccatttccagttattttgttatcaactgtaatttgttaaaactaatcttgtatatagaacaatacccaacaccttatagggtttctactgagatatgagcatctggctgtctatagtaaagaaacctgagtgccaacaatgctctgacctcaggatgtgttcctttgatccatgtagtatcctggcatgatgctctgcggttagaatcaaatactaaggttattacatgatatgagattttactatctcctccgttacaacatctttattcctggaaacttttctttcttgtgagagatttccaagtccataaaaagttctaagtacgccatcggaaaacttccttcgcagctggtcggccctataaacatggaaatgttgcaataccattttgtgagaaggaaagggaattttaagagctttcaagagtctttcaaagtgtattgagtgaagcaattgctattcatagggattatgcatttcacgtccgagcgaattccttttctggcgctgtatctgcaaacggctcaccgatatttcgacaaagttataaaatacataaatcttgggtttttacaccagagttctataatgccgcacactaaagaaagatagaagcattgagaaaacatttctattgcattttgaaggctgaacgcaggcctttcccgagttttattgtcgccaacaatcactgaggtacagcggtttaagggtctatggaatattacatctattcaatttgcaattctgctcttcttctgtaaataaagatggatttcatttaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]