GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-28 17:59:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001085976            1465 bp    mRNA    linear   VRT 24-MAY-2021
DEFINITION  Xenopus laevis claudin 1 S homeolog (cldn1.S), mRNA.
ACCESSION   NM_001085976
VERSION     NM_001085976.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 1465)
  AUTHORS   Chang DJ, Hwang YS, Cha SW, Chae JP, Hwang SH, Hahn JH, Bae YC, Lee
            HS and Park MJ.
  TITLE     Xclaudin 1 is required for the proper gastrulation in Xenopus
            laevis
  JOURNAL   Biochem. Biophys. Res. Commun. 397 (1), 75-81 (2010)
   PUBMED   20576541
  REMARK    GeneRIF: Xclaudin 1 is required for proper convergent extension
            movement during Xenopus gastrulation.
REFERENCE   2  (bases 1 to 1465)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC042293.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC042293.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN13737712 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1465
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="5S"
     gene            1..1465
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /note="claudin 1 S homeolog"
                     /db_xref="GeneID:379132"
                     /db_xref="Xenbase:XB-GENE-951614"
     misc_feature    64..66
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /note="upstream in-frame stop codon"
     CDS             151..786
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /note="Xclaudin 1"
                     /codon_start=1
                     /product="claudin 1 S homeolog"
                     /protein_id="NP_001079445.1"
                     /db_xref="GeneID:379132"
                     /db_xref="Xenbase:XB-GENE-951614"
                     /translation="
MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKSFDSLLKLDSTIQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGDKIAKDFYNMFTPTNSKYEFGPALFIGWAGAALAIIGGALLCCSCPRKETSYPPPRGYNKSAPPAGKDYV"
     misc_feature    163..696
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:419754"
     misc_feature    163..639
                     /gene="cldn1.S"
                     /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1"
                     /note="PMP22_Claudin; Region: PMP-22/EMP/MP20/Claudin
                     family"
ORIGIN      
cactgatcaactctttcttctctacttttttcttacttgggaagttttcagtctacatttacctaagagtcctccttaaacttcagcagaacagacaaggcctgcttcagagtgaggccaagttgtaacttactttatccactccaaaggatggccaacgcaggcttgcaacttttaggattcgccttagcttgtctgggctggattgggtttatagtatgtattgcaatccctcaatggaaaatgtcatcatttgctggggatgccattatcacagcacagataacctatgaaggactctggatgtcttgtgtaatgcagagcacagggcagatgcagtgcaaatcttttgactcattgctgaagctggacagtactatacaggccacccgagcattgatgatctgtggaattcttgttggtttctttgccatgtgcattgctgcagtagggatgaaatgcttgacatgtcttcaggatgatgaagtaaagaaggcaaaggttggagtagtgggaggagcactcttcattgttgctggtctctgtgttttgatagcaacagcttggtatggagataaaatcgcaaaggatttttacaatatgttcacaccaaccaattctaaatatgagtttggccctgccttatttattggatgggctggagctgcgctagcaatcattggaggtgctttgctctgttgctcttgtcccagaaaagagacttcctacccaccaccaagaggctacaataaaagtgcaccacctgctggaaaagattatgtgtaacaaaggaaatactgtatgcaactaccatggggacattaggacattattctccacttatttcattaatgttaaaggcattgcattgccttagattcagcaacagtaccatgctgtcatgttattcagcaacccagtatagcaatgacagtgataagttaatgcaggaagatattaaaatcttaaaagtcaacaatatgaattagaaaacagaaggttgtgcagatgtcagctttaatctatgtcatattattgtcttcacaaaacccacaccctaatcctataaagcttgcctaattatatacaaatactgtatatatatatatatatatatatatatatatatatatatatatatcatacttcatatcatcttcatatataactagcaacagcaatcatggttctttttcccttttgttttggtacaatataaattgcaagaattggttatattctgtgttatttctgtataaatctattttttttgttttgtatatgactgttattttcaataagcaatagtaatgaattctgtttcaaggcagaactgaatccaagcatggggtacaatgtacagacatggtttcaggcaattttttgtcagttttgtggattacttcccttatgtgatttttttaataaataagacttttacaagaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]