GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-19 14:32:34, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001082539            1661 bp    mRNA    linear   ROD 27-APR-2025
DEFINITION  Rattus norvegicus heterogeneous nuclear ribonucleoprotein D
            (Hnrnpd), transcript variant 2, mRNA.
ACCESSION   NM_001082539
VERSION     NM_001082539.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1661)
  AUTHORS   Yan,J., Du,F., Li,S.D., Yuan,Y., Jiang,J.Y., Li,S., Li,X.Y. and
            Du,Z.X.
  TITLE     AUF1 modulates TGF-beta signal in renal tubular epithelial cells
            via post-transcriptional regulation of Nedd4L expression
  JOURNAL   Biochim Biophys Acta Mol Cell Res 1865 (1), 48-56 (2018)
   PUBMED   28986222
  REMARK    GeneRIF: AUF1 might be a potential player in renal
            tubulointerstitial fibrosis through modulation of TGF-beta signal
            transduction via posttranscriptional regulation of Nedd4L.
REFERENCE   2  (bases 1 to 1661)
  AUTHORS   Castellanos-Rubio,A., Fernandez-Jimenez,N., Kratchmarov,R., Luo,X.,
            Bhagat,G., Green,P.H., Schneider,R., Kiledjian,M., Bilbao,J.R. and
            Ghosh,S.
  TITLE     A long noncoding RNA associated with susceptibility to celiac
            disease
  JOURNAL   Science 352 (6281), 91-95 (2016)
   PUBMED   27034373
REFERENCE   3  (bases 1 to 1661)
  AUTHORS   Lee,K.H., Kim,S.H., Kim,H.J., Kim,W., Lee,H.R., Jung,Y., Choi,J.H.,
            Hong,K.Y., Jang,S.K. and Kim,K.T.
  TITLE     AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic
            translation
  JOURNAL   Nucleic Acids Res 42 (6), 3590-3606 (2014)
   PUBMED   24423872
REFERENCE   4  (bases 1 to 1661)
  AUTHORS   Baltz,A.G., Munschauer,M., Schwanhausser,B., Vasile,A.,
            Murakawa,Y., Schueler,M., Youngs,N., Penfold-Brown,D., Drew,K.,
            Milek,M., Wyler,E., Bonneau,R., Selbach,M., Dieterich,C. and
            Landthaler,M.
  TITLE     The mRNA-bound proteome and its global occupancy profile on
            protein-coding transcripts
  JOURNAL   Mol Cell 46 (5), 674-690 (2012)
   PUBMED   22681889
REFERENCE   5  (bases 1 to 1661)
  AUTHORS   Castello,A., Fischer,B., Eichelbaum,K., Horos,R., Beckmann,B.M.,
            Strein,C., Davey,N.E., Humphreys,D.T., Preiss,T., Steinmetz,L.M.,
            Krijgsveld,J. and Hentze,M.W.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   6  (bases 1 to 1661)
  AUTHORS   Raineri,I., Wegmueller,D., Gross,B., Certa,U. and Moroni,C.
  TITLE     Roles of AUF1 isoforms, HuR and BRF1 in ARE-dependent mRNA turnover
            studied by RNA interference
  JOURNAL   Nucleic Acids Res 32 (4), 1279-1288 (2004)
   PUBMED   14976220
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 1661)
  AUTHORS   Arao,Y., Kikuchi,A., Ikeda,K., Nomoto,S., Horiguchi,H. and
            Kayama,F.
  TITLE     A+U-rich-element RNA-binding factor 1/heterogeneous nuclear
            ribonucleoprotein D gene expression is regulated by oestrogen in
            the rat uterus
  JOURNAL   Biochem J 361 (Pt 1), 125-132 (2002)
   PUBMED   11742537
REFERENCE   8  (bases 1 to 1661)
  AUTHORS   Faura,M., Renau-Piqueras,J., Bachs,O. and Bosser,R.
  TITLE     Differential distribution of heterogeneous nuclear
            ribonucleoproteins in rat tissues
  JOURNAL   Biochem Biophys Res Commun 217 (2), 554-560 (1995)
   PUBMED   7503735
REFERENCE   9  (bases 1 to 1661)
  AUTHORS   Ehrenman,K., Long,L., Wagner,B.J. and Brewer,G.
  TITLE     Characterization of cDNAs encoding the murine A+U-rich RNA-binding
            protein AUF1
  JOURNAL   Gene 149 (2), 315-319 (1994)
   PUBMED   7959009
REFERENCE   10 (bases 1 to 1661)
  AUTHORS   Ishikawa,F., Matunis,M.J., Dreyfuss,G. and Cech,T.R.
  TITLE     Nuclear proteins that bind the pre-mRNA 3' splice site sequence
            r(UUAG/G) and the human telomeric DNA sequence d(TTAGGG)n
  JOURNAL   Mol Cell Biol 13 (7), 4301-4310 (1993)
   PUBMED   8321232
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CO560068.1, AB046616.1 and CB798484.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CF110094.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-636               CO560068.1         1-636
            637-1290            AB046616.1         352-1005
            1291-1661           CB798484.1         23-393
FEATURES             Location/Qualifiers
     source          1..1661
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="14"
                     /map="14p22"
     gene            1..1661
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="heterogeneous nuclear ribonucleoprotein D"
                     /db_xref="GeneID:79256"
                     /db_xref="RGD:620365"
     exon            1..512
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    187..189
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="upstream in-frame stop codon"
     CDS             286..1290
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="isoform b is encoded by transcript variant 2;
                     heterogeneous nuclear ribonucleoprotein D0; hnRNP D0;
                     AU-rich element RNA-binding protein 1; AU-rich element
                     RNA-binding factor 1; RNA binding protein p45AUF1"
                     /codon_start=1
                     /product="heterogeneous nuclear ribonucleoprotein D0
                     isoform b"
                     /protein_id="NP_001076008.1"
                     /db_xref="GeneID:79256"
                     /db_xref="RGD:620365"
                     /translation="
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQGAAAAAGSGSGGGSAPGGTEGGSTEAEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGSYGYNSQGYGGYGGYDYTGYNSYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY"
     misc_feature    <448..513
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="CBFNT (NUC161) domain; Region: CBFNT; pfam08143"
                     /db_xref="CDD:311868"
     misc_feature    517..738
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="RNA recognition motif 1 (RRM1) found in
                     heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and
                     similar proteins; Region: RRM1_hnRNPD; cd12756"
                     /db_xref="CDD:410150"
     misc_feature    769..993
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="RNA recognition motif 2 (RRM2) found in
                     heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and
                     similar proteins; Region: RRM2_hnRNPD; cd12583"
                     /db_xref="CDD:241027"
     misc_feature    order(769..771,775..777,781..786,856..867,871..876,
                     883..891,895..897,901..903,952..954,973..981,985..993)
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:241027"
     exon            513..681
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            682..843
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            844..975
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            976..1075
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            1076..1222
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            1223..1320
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
     exon            1321..1648
                     /gene="Hnrnpd"
                     /gene_synonym="Auf1; Hnrpd"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcggcggcgccattaaagcgaggaggaggcgagagtggccgccgctgctacttattcttttttagtgcagccggggagagtgagagtgcgcgctgcgcgagagtgggaggcgaggggggcaggccggggagaggcgcaggagcctttgcagccacgcgcgcgccttgtcttgtgtgcctcgcgaggtagagcgggcgcgcggcggcggcggggattactttgctgctagtttcggttcgcggcggcggcgggtgtcgtctcggcggcggcggaggcagtagcactatgtcggaggagcagttcggaggggacggggcggcggcggcggcaacggcggcggtaggcggctcggcgggcgagcaggagggagccatggtggcggcggcgcagggggcagcggcggcggcgggaagcgggagcggcggcggctctgcgcccggaggcaccgaaggaggcagcaccgaggcagagggagcgaagatcgacgccagtaagaatgaggaggatgaagggaaaatgtttataggaggccttagctgggacaccacaaagaaagacctgaaggactacttttccaaatttggggacgttgtagactgcactctgaagttagatcctatcacagggcgatcaaggggttttggctttgtgctatttaaagagtcggagagtgtagataaggtcatggatcagaaagaacataaattgaatgggaaagtcattgatcctaaaagggccaaagccatgaaaacaaaagagcccgtcaaaaaaatttttgttggtggcctttctccagacacacctgaagaaaaaataagagagtactttggtggttttggtgaggttgaatccatagagctgcctatggacaacaagaccaataagaggcgtgggttctgtttcattacctttaaggaagaggaaccagtgaagaagataatggagaagaaataccacaatgttggtcttagtaaatgtgaaataaaagtagccatgtcgaaggagcagtatcagcagcagcagcagtggggatctagaggagggtttgcaggaagagctcgcggaagaggcggtggccccagtcaaaactggaaccagggatatagtaactattggaaccaaggctatggcagctatggatataacagccaagggtacggtggttatggaggatatgactacactggttacaacagctactatggatatggtgactatagcaatcagcagagtggttatgggaaagtatccagacgaggtggtcatcaaaatagctacaaaccatactaaattattccatttgcaacttatccccaacaggtggtgaagcagtattttccaatttgaagattcatttgaaggtggctcctgccacctgctaatagcagttcaaactaaattttttctatcaagttcccgaatggaagtatgacgttgggtccctctgaagtttaattctgagttctcattaaaagaatttgctttcattgttttatttcttaattgctatgcttcagtatcaatttgtgttttatgcccccctcccccccagtattgtagagcaagtcttgtgttacaagcccagtgtgacagtgtcatgatgtagtagtgtcttactggttttttaataaatccttttgtataaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]