GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:30:10, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001081572             906 bp    mRNA    linear   PRI 25-DEC-2019
DEFINITION  Pan troglodytes homeobox B1 (HOXB1), mRNA.
ACCESSION   NM_001081572 XM_001173083
VERSION     NM_001081572.1
KEYWORDS    RefSeq.
SOURCE      Pan troglodytes (chimpanzee)
  ORGANISM  Pan troglodytes
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Pan.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ977336.1.
            On Feb 17, 2007 this sequence version replaced XM_001173083.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN02189945,
                              SAMN02189948 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..906
                     /organism="Pan troglodytes"
                     /mol_type="mRNA"
                     /db_xref="taxon:9598"
                     /chromosome="17"
                     /map="17"
     gene            1..906
                     /gene="HOXB1"
                     /note="homeobox B1"
                     /db_xref="GeneID:749225"
                     /db_xref="VGNC:VGNC:9324"
     CDS             1..906
                     /gene="HOXB1"
                     /note="homeo box B1"
                     /codon_start=1
                     /product="homeobox protein Hox-B1"
                     /protein_id="NP_001075041.1"
                     /db_xref="GeneID:749225"
                     /db_xref="VGNC:VGNC:9324"
                     /translation="
MDYNRMNSFLEYPLCNRGSSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVTS"
     misc_feature    535..552
                     /gene="HOXB1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A2T6Z0.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(619..624,628..630,679..681,697..699,736..738,
                     742..747,754..759,763..771,775..780)
                     /gene="HOXB1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    619..777
                     /gene="HOXB1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:306543"
     misc_feature    order(625..627,745..747,754..759,766..768)
                     /gene="HOXB1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..577
                     /gene="HOXB1"
                     /inference="alignment:Splign:2.1.0"
     exon            578..906
                     /gene="HOXB1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggactataataggatgaattccttcttagagtacccactctgtaaccggggatccagcgcctacagcgcccacagcgccccaacctcttttcccccaagctcggctcaggcggttgacagctatgcaagcgagggccgctacggtggggggctgtccagccctgcgtttcagcagaactccggctatcccgcccagcagccgccttcgaccctgggggtgcccttccccagctccgcgccctcggggtatgctcctgccgcctgcagccccagctacgggccttctcagtactaccctctgggtcaatcagaaggagacggaggctattttcatccctcgagctacggggcccagctagggggcttgtccgatggctacggagcaggtggagccggtccggggccatatcctccgcagcatcccccttatgggaacgagcagaccgcgagctttgcaccggcctatgctgatctcctctccgaggacaaggaaacaccctgcccttcagaacctaacacccccacggcccggaccttcgactggatgaaggttaagagaaacccacccaagacagcgaaggtgtcagagccaggcctgggctcgcccagtggcctccgcaccaacttcaccacaaggcagctgacagaactggaaaaggagttccatttcaacaagtacctgagccgggcccggagggtggagattgccgccaccctggagctcaatgaaacacaggtcaagatttggttccagaaccgacgaatgaagcagaagaaacgcgagcgagagggaggtcgggtccccccagccccaccaggctgccccaaggaggcagctggagatgcctcagaccagtcgacatgcacctccccggaagcctcacccagctctgtcacctcctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]