LOCUS       NM_001081493             836 bp    mRNA    linear   ROD 29-JUL-2025
DEFINITION  Mus musculus CART prepropeptide (Cartpt), transcript variant 2,
            mRNA.
ACCESSION   NM_001081493 XM_989570
VERSION     NM_001081493.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 836)
  AUTHORS   Kim,D.W., Duncan,L.H., Xu,Z., Chang,M., Sejer,S., Terrillion,C.E.,
            Kanold,P.O., Place,E. and Blackshaw,S.
  TITLE     Decoding gene networks controlling hypothalamic and prethalamic
            neuron development
  JOURNAL   Cell Rep 44 (6), 115858 (2025)
   PUBMED   40512619
REFERENCE   2  (bases 1 to 836)
  AUTHORS   Houser,G., Vieites Prado,A., Topilko,T., Nguyen,C., Gaspar,P. and
            Renier,N.
  TITLE     Organization and development of bilateral somatosensory feedback
            projections in mice
  JOURNAL   iScience 28 (6), 112725 (2025)
   PUBMED   40538433
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 836)
  AUTHORS   Pearl,A.J., Maddern,X.J., Pinares-Garcia,P., Ursich,L.T.,
            Anversa,R.G., Shesham,A., Brown,R.M., Reed,F.M., Giardino,W.J.,
            Lawrence,A.J. and Walker,L.C.
  TITLE     Midbrain ghrelin receptor signalling regulates binge drinking in a
            sex specific manner
  JOURNAL   Nat Commun 16 (1), 2568 (2025)
   PUBMED   40089486
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 836)
  AUTHORS   Chen,C., Liu,Y. and Cang,J.
  TITLE     Accessing genetically defined cell types in the superior colliculus
            with transgenic mouse lines
  JOURNAL   iScience 28 (4), 112194 (2025)
   PUBMED   40212591
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 836)
  AUTHORS   Stein,J., Steiner,D.F. and Dey,A.
  TITLE     Processing of cocaine- and amphetamine-regulated transcript (CART)
            precursor proteins by prohormone convertases (PCs) and its
            implications
  JOURNAL   Peptides 27 (8), 1919-1925 (2006)
   PUBMED   16784796
  REMARK    Review article
REFERENCE   6  (bases 1 to 836)
  AUTHORS   Dey,A., Xhu,X., Carroll,R., Turck,C.W., Stein,J. and Steiner,D.F.
  TITLE     Biological processing of the cocaine and amphetamine-regulated
            transcript precursors by prohormone convertases, PC2 and PC1/3
  JOURNAL   J Biol Chem 278 (17), 15007-15014 (2003)
   PUBMED   12584191
  REMARK    GeneRIF: Processing of pro-CART revealed that PC2 is more potent
            than PC1/3 in generating bioactive CART I; bioactive CART II is
            solely generated by PC2; and PC1/3 is predominantly active in
            liberating the two intermediate CART fragments, 33-102 and 10-89.
REFERENCE   7  (bases 1 to 836)
  AUTHORS   Tsuruta,Y., Yoshimatsu,H., Hidaka,S., Kondou,S., Okamoto,K. and
            Sakata,T.
  TITLE     Hyperleptinemia in A(y)/a mice upregulates arcuate cocaine- and
            amphetamine-regulated transcript expression
  JOURNAL   Am J Physiol Endocrinol Metab 282 (4), E967-E973 (2002)
   PUBMED   11882520
  REMARK    GeneRIF: leptin modulates arcuate cocaine- and
            amphetamine-regulated transcript expression in obese A(y)/a mice
REFERENCE   8  (bases 1 to 836)
  AUTHORS   Asnicar,M.A., Smith,D.P., Yang,D.D., Heiman,M.L., Fox,N.,
            Chen,Y.F., Hsiung,H.M. and Koster,A.
  TITLE     Absence of cocaine- and amphetamine-regulated transcript results in
            obesity in mice fed a high caloric diet
  JOURNAL   Endocrinology 142 (10), 4394-4400 (2001)
   PUBMED   11564703
REFERENCE   9  (bases 1 to 836)
  AUTHORS   Adams,L.D., Gong,W., Vechia,S.D., Hunter,R.G. and Kuhar,M.J.
  TITLE     CART: from gene to function
  JOURNAL   Brain Res 848 (1-2), 137-140 (1999)
   PUBMED   10612705
REFERENCE   10 (bases 1 to 836)
  AUTHORS   Kristensen,P., Judge,M.E., Thim,L., Ribel,U., Christjansen,K.N.,
            Wulff,B.S., Clausen,J.T., Jensen,P.B., Madsen,O.D., Vrang,N.,
            Larsen,P.J. and Hastrup,S.
  TITLE     Hypothalamic CART is a new anorectic peptide regulated by leptin
  JOURNAL   Nature 393 (6680), 72-76 (1998)
   PUBMED   9590691
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CO427341.1, AK134656.1 and
            AV341177.1.
            
            On Oct 4, 2012 this sequence version replaced NM_001081493.1.
            
            Summary: This gene encodes preproprotein isoforms that are
            processed into multiple biologically active peptides. Expression of
            this gene is regulated by cocaine and other drugs, and is
            associated with feeding/appetite and stress response. Mice lacking
            the encoded protein are predisposed to obesity. Deficiency of the
            encoded protein in mice results in pancreatic islet dysfunction,
            impaired insulin secretion and glucose intolerance. Alternative
            splicing results in multiple transcript variants encoding different
            isoforms, which are subsequently processed into mature peptides.
            [provided by RefSeq, Jul 2015].
            
            Transcript Variant: This variant (2) uses an alternate in-frame
            splice site, compared to variant 1. The encoded isoform (2) is
            shorter than isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK134656.1, CJ172339.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN00849381,
                                           SAMN01164131 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-26                CO427341.1         369-394
            27-830              AK134656.1         2-805
            831-836             AV341177.1         251-256
FEATURES             Location/Qualifiers
     source          1..836
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="13"
                     /map="13 52.9 cM"
     gene            1..836
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="CART prepropeptide"
                     /db_xref="GeneID:27220"
                     /db_xref="MGI:MGI:1351330"
     exon            1..208
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    2..4
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="upstream in-frame stop codon"
     CDS             50..400
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="isoform 2 preproprotein is encoded by transcript
                     variant 2; cocaine- and amphetamine-regulated transcript
                     protein"
                     /codon_start=1
                     /product="cocaine- and amphetamine-regulated transcript
                     protein isoform 2 preproprotein"
                     /protein_id="NP_001074962.1"
                     /db_xref="CCDS:CCDS88509.1"
                     /db_xref="GeneID:27220"
                     /db_xref="MGI:MGI:1351330"
                     /translation="

MESSRLRLLPLLGAALLLLLPLLGARAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL"

     sig_peptide     50..130
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     proprotein      131..397
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /product="cocaine- and amphetamine-regulated transcript
                     proprotein"
     misc_feature    191..397
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="Cocaine and amphetamine regulated transcript
                     protein (CART); Region: CART; pfam06373"
                     /db_xref="CDD:461888"
     mat_peptide     254..397
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /product="CART(42-89)"
                     /note="CART I"
     mat_peptide     275..397
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /product="CART(49-89)"
                     /exception="alternative processing"
                     /note="CART II"
     exon            209..292
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /inference="alignment:Splign:2.1.0"
     exon            293..836
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /inference="alignment:Splign:2.1.0"
     regulatory      489..494
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="hexamer: AATAAA"
     polyA_site      514
                     /gene="Cartpt"
                     /gene_synonym="Cart"
     regulatory      544..549
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="hexamer: AATAAA"
     polyA_site      574
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="major polyA site"
     regulatory      810..815
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cartpt"
                     /gene_synonym="Cart"
                     /note="hexamer: AATAAA"
     polyA_site      830
                     /gene="Cartpt"
                     /gene_synonym="Cart"
ORIGIN      

ataagaagccggagagcgcagtgcccgagcagcgaggaggtccagaaccatggagagctcccgcctgcggctgctacccctcctgggcgccgccctgctgctactgctacctttgctgggtgcccgtgcccaggaggacgccgagctgcagccccgagccctggacatctactctgccgtggatgatgcgtcccacgagaaggagctgatcgaagcgttgcaagaagtcctgaagaagctcaagagtaaacgcattccgatctacgagaagaagtacggccaagtccccatgtgtgacgctggagagcagtgcgcagtgaggaaaggggccaggatcgggaagctgtgtgactgtccccgaggaacttcctgcaattctttcctcttgaagtgcttgtgaagggacgacagccgccaccttcggttcccatattccctctttcccccaaaggagcgctccattatccctggagcctggctttagcaacaataaagtttgcgttcccctcagagagcggatgggctctttccctgttgcttcaaaataaaagatttgacatcattgtgtgaaggagaatgcctcgaatggtgttggtgtgtgtgcaaagatttcttttcttgttttatccatctgacacattcttgtgaatctttctgggaagaagaggaacttcgttttaaaactgtatttttgtatgtggtgtgtcacaatgagaattagatctagttaatttgggtagatgacatcacaacccggaaaataaattgccctaaagccacacaaattgaagcatgtacaaattacacataataaagcatttttaacaattgctcac

//