GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 05:57:05, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001047108            1164 bp    mRNA    linear   ROD 27-JUL-2024
DEFINITION  Rattus norvegicus ladybird homeobox 1 (Lbx1), mRNA.
ACCESSION   NM_001047108 XM_001058110 XM_574675
VERSION     NM_001047108.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1164)
  AUTHORS   Takahashi,M. and Osumi,N.
  TITLE     Expression study of cadherin7 and cadherin20 in the embryonic and
            adult rat central nervous system
  JOURNAL   BMC Dev Biol 8, 87 (2008)
   PUBMED   18801203
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1164)
  AUTHORS   Cheng,L., Samad,O.A., Xu,Y., Mizuguchi,R., Luo,P., Shirasawa,S.,
            Goulding,M. and Ma,Q.
  TITLE     Lbx1 and Tlx3 are opposing switches in determining GABAergic versus
            glutamatergic transmitter phenotypes
  JOURNAL   Nat Neurosci 8 (11), 1510-1515 (2005)
   PUBMED   16234809
  REMARK    Erratum:[Nat Neurosci. 2005 Dec;8(12):1791]
REFERENCE   3  (bases 1 to 1164)
  AUTHORS   Muller,T., Anlag,K., Wildner,H., Britsch,S., Treier,M. and
            Birchmeier,C.
  TITLE     The bHLH factor Olig3 coordinates the specification of dorsal
            neurons in the spinal cord
  JOURNAL   Genes Dev 19 (6), 733-743 (2005)
   PUBMED   15769945
REFERENCE   4  (bases 1 to 1164)
  AUTHORS   Mizuhara,E., Nakatani,T., Minaki,Y., Sakamoto,Y. and Ono,Y.
  TITLE     Corl1, a novel neuronal lineage-specific transcriptional
            corepressor for the homeodomain transcription factor Lbx1
  JOURNAL   J Biol Chem 280 (5), 3645-3655 (2005)
   PUBMED   15528197
REFERENCE   5  (bases 1 to 1164)
  AUTHORS   Schafer,K., Neuhaus,P., Kruse,J. and Braun,T.
  TITLE     The homeobox gene Lbx1 specifies a subpopulation of cardiac neural
            crest necessary for normal heart development
  JOURNAL   Circ Res 92 (1), 73-80 (2003)
   PUBMED   12522123
REFERENCE   6  (bases 1 to 1164)
  AUTHORS   Muller,T., Brohmann,H., Pierani,A., Heppenstall,P.A., Lewin,G.R.,
            Jessell,T.M. and Birchmeier,C.
  TITLE     The homeodomain factor lbx1 distinguishes two major programs of
            neuronal differentiation in the dorsal spinal cord
  JOURNAL   Neuron 34 (4), 551-562 (2002)
   PUBMED   12062039
REFERENCE   7  (bases 1 to 1164)
  AUTHORS   Gross,M.K., Dottori,M. and Goulding,M.
  TITLE     Lbx1 specifies somatosensory association interneurons in the dorsal
            spinal cord
  JOURNAL   Neuron 34 (4), 535-549 (2002)
   PUBMED   12062038
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB197923.1.
            
            On or before Sep 7, 2006 this sequence version replaced
            XM_574675.2, XM_001058110.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB197923.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132297, SAMD00132299
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1164
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q54"
     gene            1..1164
                     /gene="Lbx1"
                     /gene_synonym="RGD1564197"
                     /note="ladybird homeobox 1"
                     /db_xref="GeneID:499362"
                     /db_xref="RGD:1564197"
     exon            1..328
                     /gene="Lbx1"
                     /gene_synonym="RGD1564197"
                     /inference="alignment:Splign:2.1.0"
     CDS             4..861
                     /gene="Lbx1"
                     /gene_synonym="RGD1564197"
                     /note="lady bird-like homeobox 1 homolog; ladybird
                     homeobox protein homolog 1"
                     /codon_start=1
                     /product="transcription factor LBX1"
                     /protein_id="NP_001040573.1"
                     /db_xref="GeneID:499362"
                     /db_xref="RGD:1564197"
                     /translation="
MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEASGGGGGGGGGGCGRAKSRPGSPALPPGAPQAPGGGPLQLSPASPLTDQRASSQDCSEDEEDEEIDVDD"
     misc_feature    4..111
                     /gene="Lbx1"
                     /gene_synonym="RGD1564197"
                     /note="propagated from UniProtKB/Swiss-Prot (Q1XID0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    379..549
                     /gene="Lbx1"
                     /gene_synonym="RGD1564197"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    637..858
                     /gene="Lbx1"
                     /gene_synonym="RGD1564197"
                     /note="propagated from UniProtKB/Swiss-Prot (Q1XID0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            329..1164
                     /gene="Lbx1"
                     /gene_synonym="RGD1564197"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gagatgacttccaaggaggacggcaaggcggcgccgggggaggagcggcggcgcagccctctggaccacctgccgccgcctgccaactccaacaagccgctgacgccgttcagcatcgaggacatcctcaacaagccgtccgtgcggagaagttactcgctgtgtggggcggcgcacctgctggcggccgcggacaagcacgcgccgggcggcttgcccctggcgggccgcgctctgctctcgcagacctcgccgctgtgcgccttggaggagctcgccagcaagacctttaaggggctggaggtcagcgtcctgcaggcagccgaaggccgcgatgggatgaccatctttgggcagaggcagacgcccaagaaacggcgaaaatcacgcacggccttcaccaaccatcagatatacgaattggagaaacgctttctataccagaagtacctgtcccctgcagaccgcgaccaaattgcgcagcagctgggcctcaccaacgcacaggtcatcacctggttccagaatcggcgcgccaagctcaagcgggatctggaggagatgaaggccgacgtggagtctgccaagaaactgggccccagcgggcagatggacatcgtggcactggcggaactcgagcagaactcggaggcttcgggcggcggcggcggcggcggcggcggtggctgcggcagagccaagtctaggccgggttctccggcgctccccccaggcgccccgcaggccccaggcggtgggcccttgcagctctctcccgcctctccgctcacggaccagcgggccagcagccaggactgctcagaggatgaggaagacgaagagatcgacgtggacgattgagctgcaccctggacctcctgccgcctgggcccccggtgcccgcatgcccgccgcctcccggaccggaccgctaaggggagctgggacctcctctgcacctcccgcctccacccttgtcccggggccggacttggcccctgacagtcgcctcttccctctcgaagcaataaatccgggccggccggcggggccggccgtcacacgcggcctccgccgccccggaagccctcgccgtgcaattctgtatggcttctgtataaatatttgagcctatatagtgggttccttccactacagcctgat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]