ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-27 00:44:54, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001035252 677 bp mRNA linear ROD 22-JUN-2025
DEFINITION Rattus norvegicus myosin light chain 2 (Myl2), mRNA.
ACCESSION NM_001035252 XM_344113
VERSION NM_001035252.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 677)
AUTHORS Dong,Y., Wang,J., Yang,C., Bao,J., Liu,X., Chen,H., Zhang,X.,
Shi,W., Zhang,L., Qi,Q., Li,Y., Wang,S., Ma,R., Cong,B. and
Zhang,G.
TITLE Phosphorylated CPI-17 and MLC2 as Biomarkers of Coronary Artery
Spasm-Induced Sudden Cardiac Death
JOURNAL Int J Mol Sci 25 (5), 2941 (2024)
PUBMED 38474189
REMARK GeneRIF: Phosphorylated CPI-17 and MLC2 as Biomarkers of Coronary
Artery Spasm-Induced Sudden Cardiac Death.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 677)
AUTHORS Han,L., Zhang,X.L., Cai,H., Yang,Z., Wang,L.H., Wei,L.S. and
Liu,T.D.
TITLE [Expression of the MYL2 gene in the development of rat testis
tissue]
JOURNAL Zhonghua Nan Ke Xue 24 (3), 206-210 (2018)
PUBMED 30161304
REMARK GeneRIF: The MYL2 gene may be involved in the proliferation of
spermatogonial stem cells and the process of sperm cells developing
into mature sperm.
REFERENCE 3 (bases 1 to 677)
AUTHORS Liu,L., Chen,L., Mai,Z., Peng,Z., Yu,K., Liu,G. and Ai,H.
TITLE Cyclical compressive stress induces differentiation of rat primary
mandibular condylar chondrocytes through phosphorylated myosin
light chain II
JOURNAL Mol Med Rep 14 (5), 4293-4300 (2016)
PUBMED 27748856
REMARK GeneRIF: Silencing MLCII by RNA interference reduced ALP activity
(P<0.01), and eliminated RUNX2 mRNA expression (P<0.01). Addition
of the MLC kinase inhibitor, ML7, reduced the CUCSassociated
upregulation of RUNX2 expression (P<0.01) and ALP activity
(P<0.01).
REFERENCE 4 (bases 1 to 677)
AUTHORS Wijnker,P.J., Li,Y., Zhang,P., Foster,D.B., dos Remedios,C., Van
Eyk,J.E., Stienen,G.J., Murphy,A.M. and van der Velden,J.
TITLE A novel phosphorylation site, Serine 199, in the C-terminus of
cardiac troponin I regulates calcium sensitivity and susceptibility
to calpain-induced proteolysis
JOURNAL J Mol Cell Cardiol 82, 93-103 (2015)
PUBMED 25771144
REFERENCE 5 (bases 1 to 677)
AUTHORS Zhang,Y.S., Liu,B., Luo,X.J., Li,T.B., Zhang,J.J., Peng,J.J.,
Zhang,X.J., Ma,Q.L., Hu,C.P., Li,Y.J., Peng,J. and Li,Q.
TITLE Nuclear cardiac myosin light chain 2 modulates NADPH oxidase 2
expression in myocardium: a novel function beyond muscle
contraction
JOURNAL Basic Res Cardiol 110 (4), 38 (2015)
PUBMED 25982880
REMARK GeneRIF: nuclear MYL2 plays an important role in IR injury by
transcriptionally upregulating NOX2 expression to enhance oxidative
stress in a phosphorylation-dependent manner.
REFERENCE 6 (bases 1 to 677)
AUTHORS Nakagawa,O., Ogawa,Y., Itoh,H., Suga,S., Komatsu,Y., Kishimoto,I.,
Nishino,K., Yoshimasa,T. and Nakao,K.
TITLE Rapid transcriptional activation and early mRNA turnover of brain
natriuretic peptide in cardiocyte hypertrophy. Evidence for brain
natriuretic peptide as an 'emergency' cardiac hormone against
ventricular overload
JOURNAL J Clin Invest 96 (3), 1280-1287 (1995)
PUBMED 7657802
REFERENCE 7 (bases 1 to 677)
AUTHORS Lee,K.J., Ross,R.S., Rockman,H.A., Harris,A.N., O'Brien,T.X., van
Bilsen,M., Shubeita,H.E., Kandolf,R., Brem,G., Price,J. et al.
TITLE Myosin light chain-2 luciferase transgenic mice reveal distinct
regulatory programs for cardiac and skeletal muscle-specific
expression of a single contractile protein gene
JOURNAL J Biol Chem 267 (22), 15875-15885 (1992)
PUBMED 1379240
REFERENCE 8 (bases 1 to 677)
AUTHORS Henderson,S.A., Spencer,M., Sen,A., Kumar,C., Siddiqui,M.A. and
Chien,K.R.
TITLE Structure, organization, and expression of the rat cardiac myosin
light chain-2 gene. Identification of a 250-base pair fragment
which confers cardiac-specific expression
JOURNAL J Biol Chem 264 (30), 18142-18148 (1989)
PUBMED 2808370
REFERENCE 9 (bases 1 to 677)
AUTHORS Henderson,S.A., Xu,Y.C. and Chien,K.R.
TITLE Nucleotide sequence of full length cDNAs encoding rat cardiac
myosin light chain-2
JOURNAL Nucleic Acids Res 16 (10), 4722 (1988)
PUBMED 3380697
REFERENCE 10 (bases 1 to 677)
AUTHORS Kumar,C.C., Cribbs,L., Delaney,P., Chien,K.R. and Siddiqui,M.A.
TITLE Heart myosin light chain 2 gene. Nucleotide sequence of full length
cDNA and expression in normal and hypertensive rat
JOURNAL J Biol Chem 261 (6), 2866-2872 (1986)
PUBMED 3005270
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from BC126064.1.
On May 10, 2012 this sequence version replaced NM_001035252.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC126064.1, FQ224033.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA5760384, SAMEA5760386
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on conservation, expression,
longest protein
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..677
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="12"
/map="12q16"
gene 1..677
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="myosin light chain 2"
/db_xref="GeneID:363925"
/db_xref="RGD:1564245"
exon 1..32
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/inference="alignment:Splign:2.1.0"
CDS 30..530
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="cardiac myosin light chain-2; myosin, light
polypeptide 2, regulatory, cardiac, slow; myosin, light
chain 2, regulatory, cardiac, slow"
/codon_start=1
/product="myosin regulatory light chain 2,
ventricular/cardiac muscle isoform"
/protein_id="NP_001030329.2"
/db_xref="GeneID:363925"
/db_xref="RGD:1564245"
/translation="
MSPKKAKKRLEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD"
misc_feature 33..35
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="N,N,N-trimethylserine.
/evidence=ECO:0000250|UniProtKB:Q3SZE5; propagated from
UniProtKB/Swiss-Prot (P08733.2); methylation site"
misc_feature 69..71
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P51667; propagated from
UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
misc_feature 72..74
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P10916; propagated from
UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
misc_feature 84..86
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P51667; propagated from
UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
misc_feature 87..509
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="calmodulin; Provisional; Region: PTZ00184"
/db_xref="CDD:185504"
misc_feature 183..185
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/note="Phosphothreonine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
exon 33..122
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/inference="alignment:Splign:2.1.0"
exon 123..198
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/inference="alignment:Splign:2.1.0"
exon 199..303
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/inference="alignment:Splign:2.1.0"
exon 304..382
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/inference="alignment:Splign:2.1.0"
exon 383..431
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/inference="alignment:Splign:2.1.0"
exon 432..648
/gene="Myl2"
/gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
/inference="alignment:Splign:2.1.0"
ORIGIN
ttcagaggcagcagccagcctcagacaccatgtcaccaaagaaagccaagaagaggttagagggcggaagctccaacgtgttctccatgtttgagcagacccagatccaggagttcaaggaggccttcacaatcatggaccagaacagagacggcttcattgacaagaatgacctaagggacacgtttgctgccctcggacgagtgaacgtgaaaaacgaagagatcgatgagatgatcaaagaggctccaggtccaattaacttcactgtgttcctcaccatgtttggggagaaacttaaaggagctgacccggaggagaccattctcaacgccttcaaggtgtttgaccccgaaggcaaagggtcgctgaaggccgactatgtccgggagatgctgaccacgcaagcagagaggttctccaaagaagagatcgaccagatgttcgcagcttttccccctgacgtcaccggcaaccttgattataagaatttggttcacatcatcacccacggagaagagaaggactgagccctgaaccacagcctcgggtgacctatagcctgttctccatccccaggccctgctgtcccagcctgcgggtgttcaccatcccagggccctgtgcaaataaacaggaagtcttggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]