GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-27 00:44:54, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001035252             677 bp    mRNA    linear   ROD 22-JUN-2025
DEFINITION  Rattus norvegicus myosin light chain 2 (Myl2), mRNA.
ACCESSION   NM_001035252 XM_344113
VERSION     NM_001035252.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 677)
  AUTHORS   Dong,Y., Wang,J., Yang,C., Bao,J., Liu,X., Chen,H., Zhang,X.,
            Shi,W., Zhang,L., Qi,Q., Li,Y., Wang,S., Ma,R., Cong,B. and
            Zhang,G.
  TITLE     Phosphorylated CPI-17 and MLC2 as Biomarkers of Coronary Artery
            Spasm-Induced Sudden Cardiac Death
  JOURNAL   Int J Mol Sci 25 (5), 2941 (2024)
   PUBMED   38474189
  REMARK    GeneRIF: Phosphorylated CPI-17 and MLC2 as Biomarkers of Coronary
            Artery Spasm-Induced Sudden Cardiac Death.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 677)
  AUTHORS   Han,L., Zhang,X.L., Cai,H., Yang,Z., Wang,L.H., Wei,L.S. and
            Liu,T.D.
  TITLE     [Expression of the MYL2 gene in the development of rat testis
            tissue]
  JOURNAL   Zhonghua Nan Ke Xue 24 (3), 206-210 (2018)
   PUBMED   30161304
  REMARK    GeneRIF: The MYL2 gene may be involved in the proliferation of
            spermatogonial stem cells and the process of sperm cells developing
            into mature sperm.
REFERENCE   3  (bases 1 to 677)
  AUTHORS   Liu,L., Chen,L., Mai,Z., Peng,Z., Yu,K., Liu,G. and Ai,H.
  TITLE     Cyclical compressive stress induces differentiation of rat primary
            mandibular condylar chondrocytes through phosphorylated myosin
            light chain II
  JOURNAL   Mol Med Rep 14 (5), 4293-4300 (2016)
   PUBMED   27748856
  REMARK    GeneRIF: Silencing MLCII by RNA interference reduced ALP activity
            (P<0.01), and eliminated RUNX2 mRNA expression (P<0.01). Addition
            of the MLC kinase inhibitor, ML7, reduced the CUCSassociated
            upregulation of RUNX2 expression (P<0.01) and ALP activity
            (P<0.01).
REFERENCE   4  (bases 1 to 677)
  AUTHORS   Wijnker,P.J., Li,Y., Zhang,P., Foster,D.B., dos Remedios,C., Van
            Eyk,J.E., Stienen,G.J., Murphy,A.M. and van der Velden,J.
  TITLE     A novel phosphorylation site, Serine 199, in the C-terminus of
            cardiac troponin I regulates calcium sensitivity and susceptibility
            to calpain-induced proteolysis
  JOURNAL   J Mol Cell Cardiol 82, 93-103 (2015)
   PUBMED   25771144
REFERENCE   5  (bases 1 to 677)
  AUTHORS   Zhang,Y.S., Liu,B., Luo,X.J., Li,T.B., Zhang,J.J., Peng,J.J.,
            Zhang,X.J., Ma,Q.L., Hu,C.P., Li,Y.J., Peng,J. and Li,Q.
  TITLE     Nuclear cardiac myosin light chain 2 modulates NADPH oxidase 2
            expression in myocardium: a novel function beyond muscle
            contraction
  JOURNAL   Basic Res Cardiol 110 (4), 38 (2015)
   PUBMED   25982880
  REMARK    GeneRIF: nuclear MYL2 plays an important role in IR injury by
            transcriptionally upregulating NOX2 expression to enhance oxidative
            stress in a phosphorylation-dependent manner.
REFERENCE   6  (bases 1 to 677)
  AUTHORS   Nakagawa,O., Ogawa,Y., Itoh,H., Suga,S., Komatsu,Y., Kishimoto,I.,
            Nishino,K., Yoshimasa,T. and Nakao,K.
  TITLE     Rapid transcriptional activation and early mRNA turnover of brain
            natriuretic peptide in cardiocyte hypertrophy. Evidence for brain
            natriuretic peptide as an 'emergency' cardiac hormone against
            ventricular overload
  JOURNAL   J Clin Invest 96 (3), 1280-1287 (1995)
   PUBMED   7657802
REFERENCE   7  (bases 1 to 677)
  AUTHORS   Lee,K.J., Ross,R.S., Rockman,H.A., Harris,A.N., O'Brien,T.X., van
            Bilsen,M., Shubeita,H.E., Kandolf,R., Brem,G., Price,J. et al.
  TITLE     Myosin light chain-2 luciferase transgenic mice reveal distinct
            regulatory programs for cardiac and skeletal muscle-specific
            expression of a single contractile protein gene
  JOURNAL   J Biol Chem 267 (22), 15875-15885 (1992)
   PUBMED   1379240
REFERENCE   8  (bases 1 to 677)
  AUTHORS   Henderson,S.A., Spencer,M., Sen,A., Kumar,C., Siddiqui,M.A. and
            Chien,K.R.
  TITLE     Structure, organization, and expression of the rat cardiac myosin
            light chain-2 gene. Identification of a 250-base pair fragment
            which confers cardiac-specific expression
  JOURNAL   J Biol Chem 264 (30), 18142-18148 (1989)
   PUBMED   2808370
REFERENCE   9  (bases 1 to 677)
  AUTHORS   Henderson,S.A., Xu,Y.C. and Chien,K.R.
  TITLE     Nucleotide sequence of full length cDNAs encoding rat cardiac
            myosin light chain-2
  JOURNAL   Nucleic Acids Res 16 (10), 4722 (1988)
   PUBMED   3380697
REFERENCE   10 (bases 1 to 677)
  AUTHORS   Kumar,C.C., Cribbs,L., Delaney,P., Chien,K.R. and Siddiqui,M.A.
  TITLE     Heart myosin light chain 2 gene. Nucleotide sequence of full length
            cDNA and expression in normal and hypertensive rat
  JOURNAL   J Biol Chem 261 (6), 2866-2872 (1986)
   PUBMED   3005270
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC126064.1.
            
            On May 10, 2012 this sequence version replaced NM_001035252.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC126064.1, FQ224033.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760384, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..677
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="12"
                     /map="12q16"
     gene            1..677
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="myosin light chain 2"
                     /db_xref="GeneID:363925"
                     /db_xref="RGD:1564245"
     exon            1..32
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /inference="alignment:Splign:2.1.0"
     CDS             30..530
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="cardiac myosin light chain-2; myosin, light
                     polypeptide 2, regulatory, cardiac, slow; myosin, light
                     chain 2, regulatory, cardiac, slow"
                     /codon_start=1
                     /product="myosin regulatory light chain 2,
                     ventricular/cardiac muscle isoform"
                     /protein_id="NP_001030329.2"
                     /db_xref="GeneID:363925"
                     /db_xref="RGD:1564245"
                     /translation="
MSPKKAKKRLEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD"
     misc_feature    33..35
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="N,N,N-trimethylserine.
                     /evidence=ECO:0000250|UniProtKB:Q3SZE5; propagated from
                     UniProtKB/Swiss-Prot (P08733.2); methylation site"
     misc_feature    69..71
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P51667; propagated from
                     UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
     misc_feature    72..74
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P10916; propagated from
                     UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
     misc_feature    84..86
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P51667; propagated from
                     UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
     misc_feature    87..509
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="calmodulin; Provisional; Region: PTZ00184"
                     /db_xref="CDD:185504"
     misc_feature    183..185
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /note="Phosphothreonine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P08733.2); phosphorylation site"
     exon            33..122
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /inference="alignment:Splign:2.1.0"
     exon            123..198
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /inference="alignment:Splign:2.1.0"
     exon            199..303
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /inference="alignment:Splign:2.1.0"
     exon            304..382
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /inference="alignment:Splign:2.1.0"
     exon            383..431
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /inference="alignment:Splign:2.1.0"
     exon            432..648
                     /gene="Myl2"
                     /gene_synonym="Mlc-2; MLC-2s/v; Mlc2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ttcagaggcagcagccagcctcagacaccatgtcaccaaagaaagccaagaagaggttagagggcggaagctccaacgtgttctccatgtttgagcagacccagatccaggagttcaaggaggccttcacaatcatggaccagaacagagacggcttcattgacaagaatgacctaagggacacgtttgctgccctcggacgagtgaacgtgaaaaacgaagagatcgatgagatgatcaaagaggctccaggtccaattaacttcactgtgttcctcaccatgtttggggagaaacttaaaggagctgacccggaggagaccattctcaacgccttcaaggtgtttgaccccgaaggcaaagggtcgctgaaggccgactatgtccgggagatgctgaccacgcaagcagagaggttctccaaagaagagatcgaccagatgttcgcagcttttccccctgacgtcaccggcaaccttgattataagaatttggttcacatcatcacccacggagaagagaaggactgagccctgaaccacagcctcgggtgacctatagcctgttctccatccccaggccctgctgtcccagcctgcgggtgttcaccatcccagggccctgtgcaaataaacaggaagtcttggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]