GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 11:38:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001025776             738 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA.
ACCESSION   NM_001025776 XM_578961
VERSION     NM_001025776.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ058655.1.
            
            On Jul 22, 2005 this sequence version replaced XM_578961.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058655.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..738
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..738
                     /gene="Rhox8"
                     /note="reproductive homeobox 8"
                     /db_xref="GeneID:503423"
                     /db_xref="RGD:1561047"
     CDS             1..537
                     /gene="Rhox8"
                     /note="reproductive homeobox on X chromosome 8; Rhox
                     homeobox family member 8"
                     /codon_start=1
                     /product="reproductive homeobox 8"
                     /protein_id="NP_001020947.1"
                     /db_xref="GeneID:503423"
                     /db_xref="RGD:1561047"
                     /translation="
MEPQEVTQYSHLRDDQIKESNEAAAWIVLQDIKEREEKEVVQGYPMLDTTATEGEGANEEESRDEITPAGSSASASVDDRSQDGGTSSNDQDKGQQKEPIPGSTKGHQASPRLPGQLSRNRHRFTEFQLQELERIFERNHYPSAAARRELARWIGVTESRVENWFKSRRAKYRKCLRM"
     misc_feature    order(355..366,370..372,421..423,439..441,478..480,
                     484..489,496..501,505..513,517..522)
                     /gene="Rhox8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(358..360,367..369,487..489,496..501,508..510)
                     /gene="Rhox8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    361..519
                     /gene="Rhox8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            1..64
                     /gene="Rhox8"
                     /inference="alignment:Splign:2.1.0"
     exon            65..440
                     /gene="Rhox8"
                     /inference="alignment:Splign:2.1.0"
     exon            441..486
                     /gene="Rhox8"
                     /inference="alignment:Splign:2.1.0"
     exon            487..738
                     /gene="Rhox8"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggaacctcaagaagtcacccagtattctcatctgagagatgatcaaattaaagaaagcaatgaagcagctgcgtggatagttttacaggatataaaggagagagaggagaaagaagttgtacagggctaccctatgttggacaccacagctacagaaggagaaggtgcaaatgaagaagaatccagagatgaaataactcctgctggcagttcagcctcagcctctgtagatgacagaagccaggatggcgggaccagcagcaatgaccaggataaaggccaacaaaaggagccaatccctgggagcacaaaaggccatcaggcttccccacgtctaccaggccagctgtcccgcaaccgccacaggttcaccgagttccagctccaggagctggagcgcattttcgaacgtaatcactatcctagtgctgcagcccgaagggagctcgcaagatggataggtgtgacagaatccagagtggagaattggtttaagagtaggagagccaagtacaggaaatgcctgaggatgtaagtgctctgaagtgctcctcatggtgctcactgtagctgcacctttccctaaagattgcggaggagaactagagaaccacctttgcccagaagcggatgagattttgctgccaccaacccattgttctaaccactcccccctcctatcttactcttatctcctcagctcttttaattgcaataaagtggtgaaatctcaata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]