GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 16:29:58, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001025065            1785 bp    mRNA    linear   ROD 03-MAY-2021
DEFINITION  Rattus norvegicus angiopoietin-like 3 (Angptl3), mRNA.
ACCESSION   NM_001025065 XM_578476
VERSION     NM_001025065.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1785)
  AUTHORS   Zhao Y, Goto M, Vaziri ND, Khazaeli M, Liu H, Farahanchi N,
            Khanifar E, Farzaneh T, Haslett PA, Moradi H and Soundarapandian
            MM.
  TITLE     RNA Interference Targeting Liver Angiopoietin-Like Protein 3
            Protects from Nephrotic Syndrome in a Rat Model Via Amelioration of
            Pathologic Hypertriglyceridemia
  JOURNAL   J Pharmacol Exp Ther 376 (3), 428-435 (2021)
   PUBMED   33443084
  REMARK    GeneRIF: RNA Interference Targeting Liver Angiopoietin-Like Protein
            3 Protects from Nephrotic Syndrome in a Rat Model Via Amelioration
            of Pathologic Hypertriglyceridemia.
REFERENCE   2  (bases 1 to 1785)
  AUTHORS   Essalmani R, Susan-Resiga D, Chamberland A, Asselin MC, Canuel M,
            Constam D, Creemers JW, Day R, Gauthier D, Prat A and Seidah NG.
  TITLE     Furin is the primary in vivo convertase of angiopoietin-like 3 and
            endothelial lipase in hepatocytes
  JOURNAL   J Biol Chem 288 (37), 26410-26418 (2013)
   PUBMED   23918928
REFERENCE   3  (bases 1 to 1785)
  AUTHORS   Quagliarini F, Wang Y, Kozlitina J, Grishin NV, Hyde R, Boerwinkle
            E, Valenzuela DM, Murphy AJ, Cohen JC and Hobbs HH.
  TITLE     Atypical angiopoietin-like protein that regulates ANGPTL3
  JOURNAL   Proc Natl Acad Sci U S A 109 (48), 19751-19756 (2012)
   PUBMED   23150577
REFERENCE   4  (bases 1 to 1785)
  AUTHORS   Sonnenburg WK, Yu D, Lee EC, Xiong W, Gololobov G, Key B, Gay J,
            Wilganowski N, Hu Y, Zhao S, Schneider M, Ding ZM, Zambrowicz BP,
            Landes G, Powell DR and Desai U.
  TITLE     GPIHBP1 stabilizes lipoprotein lipase and prevents its inhibition
            by angiopoietin-like 3 and angiopoietin-like 4
  JOURNAL   J Lipid Res 50 (12), 2421-2429 (2009)
   PUBMED   19542565
REFERENCE   5  (bases 1 to 1785)
  AUTHORS   Shimamura M, Matsuda M, Yasumo H, Okazaki M, Fujimoto K, Kono K,
            Shimizugawa T, Ando Y, Koishi R, Kohama T, Sakai N, Kotani K,
            Komuro R, Ishida T, Hirata K, Yamashita S, Furukawa H and Shimomura
            I.
  TITLE     Angiopoietin-like protein3 regulates plasma HDL cholesterol through
            suppression of endothelial lipase
  JOURNAL   Arterioscler Thromb Vasc Biol 27 (2), 366-372 (2007)
   PUBMED   17110602
REFERENCE   6  (bases 1 to 1785)
  AUTHORS   Inaba T, Matsuda M, Shimamura M, Takei N, Terasaka N, Ando Y,
            Yasumo H, Koishi R, Makishima M and Shimomura I.
  TITLE     Angiopoietin-like protein 3 mediates hypertriglyceridemia induced
            by the liver X receptor
  JOURNAL   J Biol Chem 278 (24), 21344-21351 (2003)
   PUBMED   12672813
REFERENCE   7  (bases 1 to 1785)
  AUTHORS   Ando Y, Shimizugawa T, Takeshita S, Ono M, Shimamura M, Koishi R
            and Furukawa H.
  TITLE     A decreased expression of angiopoietin-like 3 is protective against
            atherosclerosis in apoE-deficient mice
  JOURNAL   J Lipid Res 44 (6), 1216-1223 (2003)
   PUBMED   12671033
REFERENCE   8  (bases 1 to 1785)
  AUTHORS   Shimamura M, Matsuda M, Kobayashi S, Ando Y, Ono M, Koishi R,
            Furukawa H, Makishima M and Shimomura I.
  TITLE     Angiopoietin-like protein 3, a hepatic secretory factor, activates
            lipolysis in adipocytes
  JOURNAL   Biochem Biophys Res Commun 301 (2), 604-609 (2003)
   PUBMED   12565906
REFERENCE   9  (bases 1 to 1785)
  AUTHORS   Shimizugawa T, Ono M, Shimamura M, Yoshida K, Ando Y, Koishi R,
            Ueda K, Inaba T, Minekura H, Kohama T and Furukawa H.
  TITLE     ANGPTL3 decreases very low density lipoprotein triglyceride
            clearance by inhibition of lipoprotein lipase
  JOURNAL   J Biol Chem 277 (37), 33742-33748 (2002)
   PUBMED   12097324
REFERENCE   10 (bases 1 to 1785)
  AUTHORS   Camenisch G, Pisabarro MT, Sherman D, Kowalski J, Nagel M, Hass P,
            Xie MH, Gurney A, Bodary S, Liang XH, Clark K, Beresini M, Ferrara
            N and Gerber HP.
  TITLE     ANGPTL3 stimulates endothelial cell adhesion and migration via
            integrin alpha vbeta 3 and induces blood vessel formation in vivo
  JOURNAL   J Biol Chem 277 (19), 17281-17290 (2002)
   PUBMED   11877390
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC088192.1.
            On Jun 25, 2005 this sequence version replaced XM_578476.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC088192.1, EX488600.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760400
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1785
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q33"
     gene            1..1785
                     /gene="Angptl3"
                     /note="angiopoietin-like 3"
                     /db_xref="GeneID:502970"
                     /db_xref="RGD:1564505"
     exon            1..535
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    23..25
                     /gene="Angptl3"
                     /note="upstream in-frame stop codon"
     CDS             41..1009
                     /gene="Angptl3"
                     /note="angiopoietin-related protein 3"
                     /codon_start=1
                     /product="angiopoietin-related protein 3 precursor"
                     /protein_id="NP_001020236.1"
                     /db_xref="GeneID:502970"
                     /db_xref="RGD:1564505"
                     /translation="
MHTIKLLLFVVPLVISSRVDPDLSPFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELNSKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGKVISLHHSLIC"
     sig_peptide     41..88
                     /gene="Angptl3"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    761..>973
                     /gene="Angptl3"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cl00085"
                     /db_xref="CDD:294064"
     STS             211..307
                     /gene="Angptl3"
                     /standard_name="RH135495"
                     /db_xref="UniSTS:209822"
     exon            536..646
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            647..761
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            762..875
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            876..1764
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gacgttccaaattgcttgaaattgaataattgaaacaaaaatgcacacaattaagctgctcctttttgttgttcctctagtaatttcgtccagagttgatccagacctttcgccatttgattctgtaccgtcagagccaaaatcaagatttgctatgttggatgatgtcaaaattttagccaatggcctcctgcagctgggtcatggtcttaaagattttgtccataagacaaagggacaaattaatgacatatttcagaagctcaacatatttgatcagtgtttttatgacctatcacttcaaaccaatgaaatcaaagaagaggaaaaggagctaagaagaaccacatctaaactacaagttaaaaacgaagaggtgaagaatatgtcacttgaactgaactcaaagcttgaaagtctactggaggagaagatggcgctccaacacagagtcagggctttggaggaacagctgaccagcttggttcagaacccgcctggggctcgggagcacccagaggtaacgtcacttaaaagttttgtagaacagcaagataacagcataagagaactcctccagagtgtggaagaacaatataaacaactaagtcaacagcacattcagataaaagaaatagaaaatcagctcagaaagactggcattcaagaacccactgaaaattctctttattctaaaccaagagcaccaagaactactccccctcttcatctgaaggaagcaaaaaatatagaacaagatgatctgcctgctgactgctctgccatttataacagaggtgaacatacaagtggcgtgtatactattagaccaagcagctctcaagtgtttaatgtctactgtgacacccaatcaggcactccacggacattaattcaacaccggaaagatggctctcaaaacttcaaccaaacgtgggaaaactacgaaaagggttttgggaggcttgatggtaaagtgatttccttgcatcactcacttatctgttgatttaatagtattagttgggtgtgttgacacaggcctgagaccatagcgcttttgggcaaggggggaggaggagcagcaggtgaattgaaagttcaagaccagtctgggccacacattgatactccttctcgacattaagaattataaattaagcagcaattataaaatgggctgtggaaatgtaacaataagcaaaagcagaccccagtcttcataaaactgattggtaaatattatccatgatagcaactgcaatgatctcattgtacttatcactactgcatgcctgcagtatgcttgttgaaacttaattctatagttcatggttatcataagtcttattaaggaacatagtatacgccattggctctagtgaggggccatgctacaaatgagctgcaaagatagcagtatagagctctttcagtgatatcctaagcacaacgtaacacaggtgaaatgggctggaggcacagttgtggtggaacacgcggccagcaggacactgggactgatccccagcagcacaaagaaagtgataggaacacagagcgagagttagaagggacagggtcaccgtcagagatacggtgtctaactcctgcaaccctacctgtaattattccatattataaacatatactatataactgtgggtctctgcatgttctagaatatgaattctatttgattgtaaaacaaaactataaaaataagtaaaaaaataaaaaataaacagatacttaaaatcaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]