GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 15:56:11, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001024889             829 bp    mRNA    linear   ROD 16-MAR-2021
DEFINITION  Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA.
ACCESSION   NM_001024889 XM_233314
VERSION     NM_001024889.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ058652.1.
            On Jun 17, 2005 this sequence version replaced XM_233314.3.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058652.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..829
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..829
                     /gene="Rhox4g"
                     /note="reproductive homeobox 4G"
                     /db_xref="GeneID:313451"
                     /db_xref="RGD:1565307"
     CDS             1..606
                     /gene="Rhox4g"
                     /note="reproductive homeobox on X chromosome 4; homeobox
                     protein Rhox5-like; rhox homeobox family member 2-like"
                     /codon_start=1
                     /product="reproductive homeobox 4G"
                     /protein_id="NP_001020060.1"
                     /db_xref="GeneID:313451"
                     /db_xref="RGD:1565307"
                     /translation="
MEHQNTNCVLHEGLDEDKEKLNGAKAQKVLADGQGRNEGESGQDQPGSEAAAAADGEGAKELSGEGGPAAGAAGLVDNRNQEDHGTRGKDQENEKQPEKPVPEDIEVLENAQPIPVLITGVQPVPVLMPDVKPVSVLVRQRSFHYKFTRWQLQEMERIFQQNHFIGAEERRHLARWIGVSEARVQNWFKGRREQYRRQQKL"
     misc_feature    433..597
                     /gene="Rhox4g"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(436..438,556..558,565..570,577..579)
                     /gene="Rhox4g"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..67
                     /gene="Rhox4g"
                     /inference="alignment:Splign:2.1.0"
     exon            68..509
                     /gene="Rhox4g"
                     /inference="alignment:Splign:2.1.0"
     STS             430..673
                     /gene="Rhox4g"
                     /standard_name="BI278869"
                     /db_xref="UniSTS:244464"
     exon            510..555
                     /gene="Rhox4g"
                     /inference="alignment:Splign:2.1.0"
     exon            556..829
                     /gene="Rhox4g"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggagcatcaaaacaccaactgcgtacttcatgagggacttgacgaagataaggaaaaattgaatggtgcaaaggcacagaaggttttagcagatggacagggtagaaatgagggagagagtggacaggaccagcctggatctgaagcagcagcagcagcagatggggaaggagcaaaagaattaagtggagaaggtgggcccgctgctggcgctgcaggcctcgtggataacaggaaccaagaggaccatggcaccagaggcaaagaccaggagaacgagaagcagccagagaagccagtccctgaggacattgaggtcttagagaatgcgcagcctattcccgtgctgataactggtgtgcagcctgttccagtgctgatgcctgacgtaaagcctgtgtcggtgctggtacgccagcgtagcttccactacaagttcactcggtggcagctgcaggagatggagcgaattttccagcagaatcacttcatcggtgcagaagaaagaagacatctggcaagatggataggtgtgagtgaagccagagttcagaattggtttaagggaagacgagaacaatataggagacagcagaagctataaatgctcagaggggcctcttttccagaagactatgcaggagtcctagagaaccacccttgctcaagatccagatagcgataagtgtttgctaccatctacactcttatatcttcaacatctgtatttttaataaagaagtgaagtttctgcacctttgctgcatttgtttttatgaattagcaggaaatgtgtaaagtaataaaggaactctccttgaaacacg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]