GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 02:34:09, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001017361            1037 bp    mRNA    linear   PRI 25-JUL-2020
DEFINITION  Homo sapiens KH domain containing 3 like, subcortical maternal
            complex member (KHDC3L), mRNA.
ACCESSION   NM_001017361 XM_087901
VERSION     NM_001017361.3
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1037)
  AUTHORS   Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
            R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
            Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
            Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
            Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
            Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
            Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
            Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
            Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
            Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
            Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
            D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
            Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
            Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
            Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
            MA.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   2  (bases 1 to 1037)
  AUTHORS   Zhang W, Chen Z, Zhang D, Zhao B, Liu L, Xie Z, Yao Y and Zheng P.
  TITLE     KHDC3L mutation causes recurrent pregnancy loss by inducing genomic
            instability of human early embryonic cells
  JOURNAL   PLoS Biol. 17 (10), e3000468 (2019)
   PUBMED   31609975
  REMARK    GeneRIF: The study specified KHDC3L as a new recurrent pregnancy
            loss risk gene, and recognized its critical function in DNA damage
            repair pathways.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1037)
  AUTHORS   Ji M, Shi X, Xiang Y, Cui Q and Zhao J.
  TITLE     NLRP7 and KHDC3L variants in Chinese patients with recurrent
            hydatidiform moles
  JOURNAL   Jpn. J. Clin. Oncol. 49 (7), 620-627 (2019)
   PUBMED   31220306
  REMARK    GeneRIF: This study was designed to identify mutations of gene
            NLRP7 and KHDC3L in biparental complete moles.
REFERENCE   4  (bases 1 to 1037)
  AUTHORS   Nguyen NMP, Khawajkie Y, Mechtouf N, Rezaei M, Breguet M, Kurvinen
            E, Jagadeesh S, Solmaz AE, Aguinaga M, Hemida R, Harma MI, Rittore
            C, Rahimi K, Arseneau J, Hovanes K, Clisham R, Lenzi T, Scurry B,
            Addor MC, Bagga R, Nendaz GG, Finci V, Poke G, Grimes L, Gregersen
            N, York K, Bolze PA, Patel C, Mozdarani H, Puechberty J, Scotchie
            J, Fardaei M, Harma M, Gardner RJM, Sahoo T, Dudding-Byth T,
            Srinivasan R, Sauthier P and Slim R.
  TITLE     The genetics of recurrent hydatidiform moles: new insights and
            lessons from a comprehensive analysis of 113 patients
  JOURNAL   Mod. Pathol. 31 (7), 1116-1130 (2018)
   PUBMED   29463882
  REMARK    GeneRIF: all products of conception from patients with at least two
            hydatidiform moles and recessive mutations in NLRP7 or KHDC3L are
            diploid biparental, while those from patients without mutations are
            highly heterogeneous and only a minority of them are diploid
            biparental
REFERENCE   5  (bases 1 to 1037)
  AUTHORS   Liu C, Li M, Li T, Zhao H, Huang J, Wang Y, Gao Q, Yu Y and Shi Q.
  TITLE     ECAT1 is essential for human oocyte maturation and pre-implantation
            development of the resulting embryos
  JOURNAL   Sci Rep 6, 38192 (2016)
   PUBMED   27917907
  REMARK    GeneRIF: study indicates that ECAT1 may play a role in meiotic
            progression by maintaining the accuracy of spindle assembly in
            human oocytes, thus promoting oocyte maturation and subsequent
            development of the embryo.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1037)
  AUTHORS   Fallahian M, Sebire NJ, Savage PM, Seckl MJ and Fisher RA.
  TITLE     Mutations in NLRP7 and KHDC3L confer a complete hydatidiform mole
            phenotype on digynic triploid conceptions
  JOURNAL   Hum. Mutat. 34 (2), 301-308 (2013)
   PUBMED   23125094
  REMARK    GeneRIF: Both NLRP7 and KHDC3L are involved in setting or
            maintaining the appropriate imprint within the ovum in women with
            familial recurrent hydatidiform mole.
REFERENCE   7  (bases 1 to 1037)
  AUTHORS   Andreasen L, Bolund L, Niemann I, Hansen ES and Sunde L.
  TITLE     Mosaic moles and non-familial biparental moles are not caused by
            mutations in NLRP7, NLRP2 or C6orf221
  JOURNAL   Mol. Hum. Reprod. 18 (12), 593-598 (2012)
   PUBMED   22909446
  REMARK    GeneRIF: Observations suggest that although NLRP7 and C6orf221
            mutations are related to diploid biparental FRHMs, neither of these
            genes, nor NLRP2, are related to diploid HMs with biparental
            contributions to the molar genome.
REFERENCE   8  (bases 1 to 1037)
  AUTHORS   Parry DA, Logan CV, Hayward BE, Shires M, Landolsi H, Diggle C,
            Carr I, Rittore C, Touitou I, Philibert L, Fisher RA, Fallahian M,
            Huntriss JD, Picton HM, Malik S, Taylor GR, Johnson CA, Bonthron DT
            and Sheridan EG.
  TITLE     Mutations causing familial biparental hydatidiform mole implicate
            c6orf221 as a possible regulator of genomic imprinting in the human
            oocyte
  JOURNAL   Am. J. Hum. Genet. 89 (3), 451-458 (2011)
   PUBMED   21885028
  REMARK    GeneRIF: Mutations causing familial biparental hydatidiform mole
            implicate c6orf221 as a possible regulator of genomic imprinting in
            the human oocyte.
REFERENCE   9  (bases 1 to 1037)
  AUTHORS   Pierre A, Gautier M, Callebaut I, Bontoux M, Jeanpierre E,
            Pontarotti P and Monget P.
  TITLE     Atypical structure and phylogenomic evolution of the new eutherian
            oocyte- and embryo-expressed KHDC1/DPPA5/ECAT1/OOEP gene family
  JOURNAL   Genomics 90 (5), 583-594 (2007)
   PUBMED   17913455
  REMARK    GeneRIF: This paper states that ECAT1 is not found in rodents.
REFERENCE   10 (bases 1 to 1037)
  AUTHORS   Mitsui K, Tokuzawa Y, Itoh H, Segawa K, Murakami M, Takahashi K,
            Maruyama M, Maeda M and Yamanaka S.
  TITLE     The homeoprotein Nanog is required for maintenance of pluripotency
            in mouse epiblast and ES cells
  JOURNAL   Cell 113 (5), 631-642 (2003)
   PUBMED   12787504
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC019205.4, AB211062.1 and
            AI638315.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Nov 23, 2018 this sequence version replaced NM_001017361.2.
            
            Summary: The protein encoded by this gene belongs to the KHDC1
            family, members of which contain an atypical KH domain that may not
            bind RNA like canonical KH domains. This gene is specifically
            expressed in the oocytes, and recent studies suggest that it may
            function as a regulator of genomic imprinting in the oocyte.
            Mutations in this gene are associated with recurrent biparental
            complete hydatidiform mole. [provided by RefSeq, Dec 2011].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB211062.1, BC132844.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968968, SAMEA2142363
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000370367.4/ ENSP00000359392.3
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-19                AC019205.4         80885-80903         c
            20-904              AB211062.1         1-885
            905-1037            AI638315.1         10-142              c
FEATURES             Location/Qualifiers
     source          1..1037
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6q13"
     gene            1..1037
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /note="KH domain containing 3 like, subcortical maternal
                     complex member"
                     /db_xref="GeneID:154288"
                     /db_xref="HGNC:HGNC:33699"
                     /db_xref="MIM:611687"
     exon            1..241
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /inference="alignment:Splign:2.1.0"
     variation       3
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1305069572"
     variation       5
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:535114156"
     variation       9
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:954877750"
     variation       10
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778501993"
     variation       17
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1022527171"
     variation       22
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400417344"
     variation       28
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368756507"
     variation       29
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770253703"
     variation       30
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1192756306"
     variation       31
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1562274416"
     variation       32
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1476901753"
     variation       37
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773337596"
     variation       39
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1267870291"
     variation       40
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411888708"
     variation       41
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421014012"
     variation       43
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1194329671"
     variation       49
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1019814442"
     variation       53
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:999795233"
     variation       55
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582618908"
     variation       56
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562274427"
     variation       58
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1562274429"
     variation       59
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1214452457"
     variation       60
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1312466796"
     variation       61
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582618914"
     variation       62
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1363771323"
     variation       64
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371916561"
     variation       67
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315216321"
     variation       68
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766529626"
     CDS             73..726
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /note="ES cell-associated transcript 1 protein"
                     /codon_start=1
                     /product="KHDC3-like protein"
                     /protein_id="NP_001017361.1"
                     /db_xref="CCDS:CCDS34484.1"
                     /db_xref="GeneID:154288"
                     /db_xref="HGNC:HGNC:33699"
                     /db_xref="MIM:611687"
                     /translation="
MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL"
     misc_feature    106..426
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /note="FILIA-N KH-like domain; Region: FILIA_N_like;
                     cd12795"
                     /db_xref="CDD:240613"
     misc_feature    order(232..234,256..258,262..270,277..285,352..357,
                     364..366,376..378,385..390,397..399)
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240613"
     variation       73
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:606231235"
     variation       74
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774559307"
     variation       75
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:606231233"
     variation       78
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1376501368"
     variation       79
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:879587586"
     variation       80
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149498621"
     variation       82
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:763895578"
     variation       83
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968324083"
     variation       85
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753622103"
     variation       86
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144291287"
     variation       87
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192258859"
     variation       88
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369951888"
     variation       89
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1235991286"
     variation       91
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75347618"
     variation       95
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757863032"
     variation       96
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148734762"
     variation       98
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1249850571"
     variation       99
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751290906"
     variation       101
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953883035"
     variation       102
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1260917217"
     variation       103..111
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="gtgcaactg"
                     /replace="gtgcaactggtgcaactg"
                     /db_xref="dbSNP:767338149"
     variation       103
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372943893"
     variation       106
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1434551745"
     variation       112
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781673395"
     variation       120
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1221868722"
     variation       121
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:992667093"
     variation       123
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238657557"
     variation       127
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:916019714"
     variation       130
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322317733"
     variation       132
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1457652305"
     variation       136
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1443861825"
     variation       138
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748502124"
     variation       140
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582619034"
     variation       145
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770321628"
     variation       149
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778156260"
     variation       152
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749321389"
     variation       153
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759991776"
     variation       155
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:948834870"
     variation       158
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1320685019"
     variation       159
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294023116"
     variation       160
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774504582"
     variation       161
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1276200335"
     variation       162
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1380010571"
     variation       163
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11757433"
     variation       165
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147578781"
     variation       168
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450728642"
     variation       170
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370624464"
     variation       177
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1582619086"
     variation       178
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776478308"
     variation       186
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761576316"
     variation       192
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765167528"
     variation       202
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750335286"
     variation       205
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1454188248"
     variation       207
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1189863727"
     variation       209
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422022614"
     variation       211
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331854549"
     variation       213
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411301722"
     variation       219
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762515244"
     variation       224
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399075773"
     variation       226
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199603559"
     variation       227
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751166286"
     variation       232
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371303837"
     variation       234
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143024400"
     variation       238
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:929269698"
     variation       241
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440019881"
     exon            242..421
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /inference="alignment:Splign:2.1.0"
     variation       243
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1287010583"
     variation       244
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565995615"
     variation       245
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374313878"
     variation       249
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764340927"
     variation       253
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867518396"
     variation       255
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582619276"
     variation       256
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754239047"
     variation       259
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1220400228"
     variation       262..265
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="ccgc"
                     /db_xref="dbSNP:1358852024"
     variation       262
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757753553"
     variation       263
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242601835"
     variation       267
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779450044"
     variation       268
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1472212686"
     variation       272
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160929985"
     variation       274
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745893907"
     variation       275
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368489194"
     variation       277
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747220627"
     variation       280
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768973646"
     variation       282
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772853011"
     variation       284
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562274631"
     variation       288
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1416385691"
     variation       290
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1313778100"
     variation       292
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1017140810"
     variation       295
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1242748018"
     variation       297
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749162016"
     variation       298
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762594964"
     variation       301
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562274648"
     variation       302
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371170722"
     variation       305
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1284333865"
     variation       307
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1582619348"
     variation       308
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759075200"
     variation       314
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766956568"
     variation       316
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:962525376"
     variation       317
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199912037"
     variation       318
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760211661"
     variation       319
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184819856"
     variation       321
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754185769"
     variation       322
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1490312311"
     variation       324
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484314020"
     variation       333
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1264000159"
     variation       341
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757635370"
     variation       342
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:939338468"
     variation       344
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765669871"
     variation       347
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750962169"
     variation       348
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:992597167"
     variation       349
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758458914"
     variation       350..355
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="ctt"
                     /replace="cttctt"
                     /db_xref="dbSNP:1313763065"
     variation       355
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:755150941"
     variation       360
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:137982888"
     variation       361
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:564533"
     variation       362
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:948114638"
     variation       364
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336360475"
     variation       366
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1173042105"
     variation       368..374
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="caa"
                     /replace="caatcaa"
                     /db_xref="dbSNP:606231286"
     variation       373
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424090503"
     variation       375
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:557106225"
     variation       376
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749023879"
     variation       379
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1413688722"
     variation       381
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:890420715"
     variation       382
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:770880272"
     variation       383
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:774379337"
     variation       387
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1235530130"
     variation       390
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1380004921"
     variation       391
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270591535"
     variation       392..397
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="ct"
                     /replace="ctgact"
                     /db_xref="dbSNP:606231234"
     variation       395
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:944684151"
     variation       397
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255730447"
     variation       398
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1343870367"
     variation       399
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172827855"
     variation       401
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582619471"
     variation       405
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198305822"
     variation       406
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745776920"
     variation       410
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374197577"
     variation       411
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039476426"
     variation       413
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772083749"
     variation       417
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760286211"
     variation       421
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768132139"
     exon            422..1037
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /inference="alignment:Splign:2.1.0"
     variation       423
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1489820494"
     variation       430
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769070031"
     variation       433
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1267639775"
     variation       438
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933529284"
     variation       440
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1384312110"
     variation       443
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:546109354"
     variation       445
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140227556"
     variation       447
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1582619686"
     variation       454
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:902646106"
     variation       455
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368968805"
     variation       456
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1222808642"
     variation       458
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:145650848"
     variation       460
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761435959"
     variation       466
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1487310284"
     variation       470
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151102141"
     variation       471
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773563196"
     variation       472
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763433087"
     variation       474
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:564440304"
     variation       475
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:531383488"
     variation       476
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488094962"
     variation       478..515
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="tc"
                     /replace="tcttcaatagaagtccgggaggccgggacgcagcgttc"
                     /db_xref="dbSNP:1191856901"
     variation       478
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:759484258"
     variation       479
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1302690286"
     variation       482
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779270209"
     variation       483
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:549971311"
     variation       484
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752863062"
     variation       485
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756397634"
     variation       487
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1022599477"
     variation       490..539
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="gtccgggaggccgggac"
                     /replace="gtccgggaggccgggacgcagcgttcggtggaggtccgggaggccggg
                     ac"
                     /replace="gtccgggaggccgggacgcagcgttcggtggaggtccgggaggccggg
                     acgcagcgttcggtggaggtccgggaggccgggac"
                     /db_xref="dbSNP:1384034779"
     variation       490
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:561595924"
     variation       491
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562274861"
     variation       492..505
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="ccggga"
                     /replace="ccgggaggccggga"
                     /db_xref="dbSNP:753925032"
     variation       494
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1455756972"
     variation       495
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426953758"
     variation       496
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143527822"
     variation       497
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778196357"
     variation       499
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750124331"
     variation       501
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758213353"
     variation       502
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1296027463"
     variation       503
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356955555"
     variation       504
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779819678"
     variation       507
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1178317016"
     variation       508..554
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="cagcgttcggtgga"
                     /replace="cagcgttcggtggaggtccgggaggccgggacccagcgttcggtgga"
                     /replace="cagcgttcggtggaggtccgggaggccgggacccagcgttcggtggag
                     gtccgggaggccgggacccagcgttcggtgga"
                     /db_xref="dbSNP:755542796"
     variation       509
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:970134596"
     variation       511
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746993238"
     variation       511
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1311338803"
     variation       515
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1241027501"
     variation       518
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562274879"
     variation       519..520
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1562274883"
     variation       519
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780652763"
     variation       520
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:267601110"
     variation       522
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1486578798"
     variation       523..545
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="gtccgggaggccgggacccagcg"
                     /replace="gtccgggaggccgggacccagcggtcttcaatagaagtccgggaggcc
                     gggacccagcg"
                     /db_xref="dbSNP:1562274891"
     variation       523..539
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="gtccgggaggccgggac"
                     /replace="gtccgggaggccgggacgcagcgttcggtggaagtccgggaggccggg
                     ac"
                     /db_xref="dbSNP:1562274888"
     variation       527
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867183004"
     variation       528..613
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="ggaggccgggacccagc"
                     /replace="ggaggccgggacccagcgttcggtggaagtccaggaggtcgggacaca
                     gggttctccggtggaggtgcaggaggccgggacccagc"
                     /db_xref="dbSNP:1562274898"
     variation       528
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1415006512"
     variation       531
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1352786998"
     variation       532
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1214149229"
     variation       534..572
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="cgggac"
                     /replace="cgggacccagcgttcggtggaagtccaggaggtcgggac"
                     /db_xref="dbSNP:1214649224"
     variation       534
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747724589"
     variation       535
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:769425065"
     variation       538
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:779501573"
     variation       538
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367829712"
     variation       540
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139884562"
     variation       545
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159857446"
     variation       548
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771348060"
     variation       549
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993890975"
     variation       555
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546943857"
     variation       558
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149813497"
     variation       559..601
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="caggaggtcgggacacagggttctccggtggaggtgcaggagg"
                     /replace="caggaggtcgggacacagggttctccggtggaggtgcaggaggtcggg
                     acacagggttctccggtggaggtgcaggagg"
                     /db_xref="dbSNP:753246137"
     variation       560
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768202601"
     variation       564
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775695947"
     variation       566
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430362385"
     variation       567
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372017888"
     variation       569
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764341899"
     variation       572
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466187951"
     variation       575
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754125013"
     variation       577
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758082018"
     variation       578
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766179045"
     variation       579
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1309945219"
     variation       580
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562274929"
     variation       583
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1420968441"
     variation       584
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376952167"
     variation       585
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1376020646"
     variation       588
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983603657"
     variation       591
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368252944"
     variation       594
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:565335780"
     variation       595
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747602045"
     variation       596
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200454909"
     variation       598
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1254478088"
     variation       600
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:912085147"
     variation       601
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755627817"
     variation       602
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1179315654"
     variation       603
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61746688"
     variation       604
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748946658"
     variation       606
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140872763"
     variation       608
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921916889"
     variation       609
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774772638"
     variation       612
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61746689"
     variation       613
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772644928"
     variation       614
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1174999673"
     variation       619
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357049411"
     variation       623
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:776143413"
     variation       624
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760793883"
     variation       626
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1399480123"
     variation       632
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764295033"
     variation       636
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776626414"
     variation       638
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868642236"
     variation       639
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144624088"
     variation       640
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:925285023"
     variation       641
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218416698"
     variation       644
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146663357"
     variation       645
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1309455824"
     variation       646
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463521938"
     variation       649
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1199389748"
     variation       652
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1352672567"
     variation       653
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1257451545"
     variation       654
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754781306"
     variation       655
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200036428"
     variation       657
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367677172"
     variation       659
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1477932850"
     variation       661
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1386511019"
     variation       663
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756091222"
     variation       665
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1181386957"
     variation       667
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:924015567"
     variation       668
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422658659"
     variation       670
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1478569813"
     variation       672
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:555935608"
     variation       674
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561930"
     variation       681
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250095769"
     variation       684
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422197973"
     variation       685
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756918113"
     variation       686
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373443240"
     variation       691
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866082650"
     variation       694
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1350378111"
     variation       699
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:553544698"
     variation       702
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780661477"
     variation       703
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:578059080"
     variation       704
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:545413359"
     variation       705
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776772428"
     variation       708
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761858437"
     variation       711
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235200861"
     variation       712
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61740617"
     variation       714
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770000920"
     variation       714
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="t"
                     /replace="tgtctttctctgtgt"
                     /db_xref="dbSNP:1562275035"
     variation       715..716
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace=""
                     /replace="atacccac"
                     /db_xref="dbSNP:1562275042"
     variation       715
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376848709"
     variation       718
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143606304"
     variation       721
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1044705578"
     variation       724
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202161970"
     variation       728
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489067451"
     variation       729
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760602354"
     variation       730
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763995195"
     variation       731
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371374179"
     variation       738
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756721283"
     variation       741
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1414490653"
     variation       746
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778586031"
     variation       747
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750119584"
     variation       748
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758177277"
     variation       754
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1405421289"
     variation       758
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400379268"
     variation       759
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297884288"
     variation       760..763
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1403276894"
     variation       760
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201481971"
     variation       761
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747449780"
     variation       763
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1004649367"
     variation       766
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356276799"
     variation       769
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227035080"
     variation       770
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1286945502"
     variation       771
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181090656"
     variation       777
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423671842"
     variation       778
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1216313331"
     variation       788
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:529101981"
     variation       789
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1019090995"
     variation       795
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:966614027"
     variation       797
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:896303659"
     variation       803
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248803984"
     variation       806
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023958549"
     variation       807
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1490636395"
     variation       809
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1271218943"
     variation       812
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582620079"
     variation       820..825
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:1220328501"
     variation       823
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:969302554"
     variation       830
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261499095"
     variation       835
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1000800174"
     variation       838
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3195684"
     variation       839
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1314925598"
     variation       845
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305944853"
     variation       851
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417733121"
     variation       855
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224119738"
     variation       871..876
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="taa"
                     /replace="taataa"
                     /db_xref="dbSNP:1411311999"
     variation       873
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974978728"
     variation       878
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1347308827"
     variation       885
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032302298"
     variation       890
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300804551"
     variation       898
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1403769957"
     variation       899..920
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="ccccccgcctc"
                     /replace="ccccccgcctcccccccgcctc"
                     /replace="ccccccgcctcccccccgcctcccccccgcctc"
                     /db_xref="dbSNP:1290291697"
     variation       904
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547083599"
     variation       905
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1029650791"
     variation       908
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1158881307"
     variation       909..915
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /replace="cccccccc"
                     /db_xref="dbSNP:113486455"
     variation       909
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:923418459"
     variation       910
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1449883838"
     variation       912
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:559059803"
     variation       913
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:968357637"
     variation       914
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:979383209"
     variation       915..916
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1562275138"
     variation       915
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1222774175"
     variation       916
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326523366"
     variation       924
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1297011318"
     variation       925
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923961619"
     variation       927
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:955025569"
     variation       941
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383770896"
     variation       944
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:532735031"
     variation       945
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1429929912"
     variation       946
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:910725555"
     variation       947
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:551370250"
     variation       951
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1268202111"
     variation       954
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1204286084"
     variation       960
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:992210178"
     variation       962
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195399870"
     variation       965..966
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1220730811"
     variation       973
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1247612375"
     variation       980
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204507113"
     variation       982
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260962452"
     variation       985
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202961776"
     variation       987
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:917048060"
     variation       991
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1224578892"
     variation       996
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1325529617"
     variation       998
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:949919694"
     variation       1000..1007
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="caacacaa"
                     /replace="caacacaacacaa"
                     /db_xref="dbSNP:919560993"
     variation       1000
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1385450960"
     variation       1006
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1562275168"
     variation       1012
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323068498"
     variation       1019
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1414461181"
     variation       1028
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2295761"
     variation       1031
                     /gene="KHDC3L"
                     /gene_synonym="C6orf221; ECAT1; HYDM2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1245040997"
ORIGIN      
ctagtctcccagctccagctcggcctttgggtttgctgtggtgtccttgtctcctgcaggaccggccgcagcatggacgctcccaggcggtttccgacgctcgtgcaactgatgcagccaaaagcaatgccagtggaggtgctcggtcacctccctaagcggttctcctggttccactctgagttcctgaagaatccgaaggtagttcgccttgaggtttggctggtggaaaagatcttcggccggggcggagaacgcatcccgcacgtccagggtatgtcccaaatcttgattcacgtgaatcgattggaccctaacggcgaggctgagatcttggtatttgggaggccttcttaccaggaggacacaatcaagatgatcatgaacctggctgactatcaccgccagctccaggcgaaaggctcaggaaaggccctcgcccaggatgtcgccactcagaaggccgagacccagcggtcttcaatagaagtccgggaggccgggacgcagcgttcggtggaggtccgggaggccgggacccagcgttcggtggaagtccaggaggtcgggacacagggttctccggtggaggtgcaggaggccgggacccagcagtctctccaggctgccaacaagtcggggacccagcgatcccccgaagctgccagcaaggcagtgacccagcggtttcgcgaggatgcccgggacccagttactagattatgaaggcatctcaggccctggagccagagccagtcaggggttaaagtgaaagcccgtatttccgcccagaagctggggttggggagaggatgtggattttttgttttaccctttctgttgcatggttgcaaacacaaacttgagttctaataaagaattgcaaagtggaagcccgccccccgcctcccccccgcctcacttaagtccaggaagctggggtggcgaggaaggatgatgtggattgtttttgttttacaccttctgttgaatggttgccaacacaaacttgagttctaataaataattgcatttcc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]