GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 15:34:37, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_001013429            1549 bp    mRNA    linear   ROD 14-FEB-2021
DEFINITION  Rattus norvegicus claudin 14 (Cldn14), mRNA.
ACCESSION   NM_001013429 XM_221634
VERSION     NM_001013429.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1549)
  AUTHORS   Frische S, Alexander RT, Ferreira P, Tan RSG, Wang W, Svenningsen
            P, Skjodt K and Dimke H.
  TITLE     Localization and regulation of claudin-14 in experimental models of
            hypercalcemia
  JOURNAL   Am J Physiol Renal Physiol 320 (1), F74-F86 (2021)
   PUBMED   33283646
  REMARK    GeneRIF: Localization and regulation of claudin-14 in experimental
            models of hypercalcemia.
REFERENCE   2  (bases 1 to 1549)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   3  (bases 1 to 1549)
  AUTHORS   Charoenphandhu N, Wongdee K, Tudpor K, Pandaranandaka J and
            Krishnamra N.
  TITLE     Chronic metabolic acidosis upregulated claudin mRNA expression in
            the duodenal enterocytes of female rats
  JOURNAL   Life Sci 80 (19), 1729-1737 (2007)
   PUBMED   17383680
REFERENCE   4  (bases 1 to 1549)
  AUTHORS   Nunes FD, Lopez LN, Lin HW, Davies C, Azevedo RB, Gow A and Kachar
            B.
  TITLE     Distinct subdomain organization and molecular composition of a
            tight junction with adherens junction features
  JOURNAL   J Cell Sci 119 (Pt 23), 4819-4827 (2006)
   PUBMED   17130295
REFERENCE   5  (bases 1 to 1549)
  AUTHORS   Hu YH, Warnatz HJ, Vanhecke D, Wagner F, Fiebitz A, Thamm S, Kahlem
            P, Lehrach H, Yaspo ML and Janitz M.
  TITLE     Cell array-based intracellular localization screening reveals novel
            functional features of human chromosome 21 proteins
  JOURNAL   BMC Genomics 7, 155 (2006)
   PUBMED   16780588
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1549)
  AUTHORS   Wilcox ER, Burton QL, Naz S, Riazuddin S, Smith TN, Ploplis B,
            Belyantseva I, Ben-Yosef T, Liburd NA, Morell RJ, Kachar B, Wu DK,
            Griffith AJ, Riazuddin S and Friedman TB.
  TITLE     Mutations in the gene encoding tight junction claudin-14 cause
            autosomal recessive deafness DFNB29
  JOURNAL   Cell 104 (1), 165-172 (2001)
   PUBMED   11163249
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC091387.1.
            On Apr 20, 2005 this sequence version replaced XM_221634.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC091387.1, CO562732.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760400
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1549
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="11"
                     /map="11q11"
     gene            1..1549
                     /gene="Cldn14"
                     /note="claudin 14"
                     /db_xref="GeneID:304073"
                     /db_xref="RGD:1309165"
     exon            1..400
                     /gene="Cldn14"
                     /inference="alignment:Splign:2.1.0"
     exon            401..1416
                     /gene="Cldn14"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    436..438
                     /gene="Cldn14"
                     /note="upstream in-frame stop codon"
     CDS             481..1200
                     /gene="Cldn14"
                     /codon_start=1
                     /product="claudin-14"
                     /protein_id="NP_001013447.1"
                     /db_xref="GeneID:304073"
                     /db_xref="RGD:1309165"
                     /translation="
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV"
     misc_feature    547..1023
                     /gene="Cldn14"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:419754"
     STS             507..751
                     /gene="Cldn14"
                     /standard_name="Cldn14"
                     /db_xref="UniSTS:259055"
ORIGIN      
cagggaggtcagaaaaggctgacacaggacagtgagtaggaaaggtgaggtttcacctgccaggcacagggacccattagccagccgtgtgtagacatctctggcattcttgtatcaaatgcagatatgacatttctggttggtcttgaatgtttgcctcagcagggccaccttgtagggcgcaccagctagttaatcttctaaccagagggcatgtatgcccacgcaggccccactcagagaccgtaattgaccagaccactgtctcgcaagcaccctggccttgaagctcccatttggtgaatgaggctaagctggaagtcttcagtgtccttgctgtgtctccggggtctacctgcgtcggagtgtcgaggtggatgggactcgagctgttctgtatgcctcccgcgggcacctaaggaccagatccatccctgaggacctgggcactgcccggcgcggctagcggagccctcgaccatggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtgggaacgctcatcactactatcctgccgcactggcggaggacggcccatgtgggcaccaacatcctgacggccgtgtcctacctgaagggactgtggatggagtgtgtgtggcacagcacaggcatctaccagtgtcagatctaccgctcgctgctggcgctaccccgggacctacaggcggcccgggcgctcatggtcatctcctgcctgctgtcgggcatggcctgcgcctgcgccgtagtgggcatgaagtgcactcgctgtgccaagggcacacccgccaagaccaccttcgcggtgttgggaggcgcgctcttcctgctggcaggcctgctgtgcatggtggctgtgtcctggaccacgaatgatgtggtgcagaatttttacaaccctctgctgcccagtggcatgaagtttgagatcggccaggccctgtacctgggcttcatctcctcatccctgtctctcatcgggggcaccctgctctgcctgtcgtgccaggacgagggcccctacagaccctaccagccccagtccagggctggggccaccaccacagccaccgcccctgcctaccgcccaccagcagcctacaaggacaaccgtgccccctcggtgacctcagctgcacacagtgggtacaggttgaatgactatgtgtgagttccctccccaggcttctgccagggatgttgggccccaaaggaccagtgaaggatgtagagtcctttgtaaacgtggggaagtaagtctggaatacagggaagaagggtgctcttcaaagcaaagacttctaaaaagtgctggttttgtatttattatatgtatttatgtgggtggtttaataagagctcaataaagaatacttggaagattggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]