2025-10-22 08:53:05, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001013429 1549 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus claudin 14 (Cldn14), mRNA. ACCESSION NM_001013429 XM_221634 VERSION NM_001013429.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1549) AUTHORS Cai M, Shao J, Wang Y, Yung B, Li JN, Zhang HH, Li YT and Yao DB. TITLE Claudin 14/15 play important roles in early wallerian degeneration after rat sciatic nerve injury JOURNAL Chin J Traumatol 24 (6), 374-382 (2021) PUBMED 33903003 REMARK GeneRIF: Claudin 14/15 play important roles in early wallerian degeneration after rat sciatic nerve injury. REFERENCE 2 (bases 1 to 1549) AUTHORS Frische S, Alexander RT, Ferreira P, Tan RSG, Wang W, Svenningsen P, Skjodt K and Dimke H. TITLE Localization and regulation of claudin-14 in experimental models of hypercalcemia JOURNAL Am J Physiol Renal Physiol 320 (1), F74-F86 (2021) PUBMED 33283646 REMARK GeneRIF: Localization and regulation of claudin-14 in experimental models of hypercalcemia. REFERENCE 3 (bases 1 to 1549) AUTHORS Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig IE. TITLE Structure and function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 4 (bases 1 to 1549) AUTHORS Charoenphandhu N, Wongdee K, Tudpor K, Pandaranandaka J and Krishnamra N. TITLE Chronic metabolic acidosis upregulated claudin mRNA expression in the duodenal enterocytes of female rats JOURNAL Life Sci 80 (19), 1729-1737 (2007) PUBMED 17383680 REFERENCE 5 (bases 1 to 1549) AUTHORS Nunes FD, Lopez LN, Lin HW, Davies C, Azevedo RB, Gow A and Kachar B. TITLE Distinct subdomain organization and molecular composition of a tight junction with adherens junction features JOURNAL J Cell Sci 119 (Pt 23), 4819-4827 (2006) PUBMED 17130295 REFERENCE 6 (bases 1 to 1549) AUTHORS Hu YH, Warnatz HJ, Vanhecke D, Wagner F, Fiebitz A, Thamm S, Kahlem P, Lehrach H, Yaspo ML and Janitz M. TITLE Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins JOURNAL BMC Genomics 7, 155 (2006) PUBMED 16780588 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 1549) AUTHORS Wilcox ER, Burton QL, Naz S, Riazuddin S, Smith TN, Ploplis B, Belyantseva I, Ben-Yosef T, Liburd NA, Morell RJ, Kachar B, Wu DK, Griffith AJ, Riazuddin S and Friedman TB. TITLE Mutations in the gene encoding tight junction claudin-14 cause autosomal recessive deafness DFNB29 JOURNAL Cell 104 (1), 165-172 (2001) PUBMED 11163249 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC091387.1. On Apr 20, 2005 this sequence version replaced XM_221634.2. ##Evidence-Data-START## Transcript exon combination :: BC091387.1, CO562732.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760400 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1549 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="11" /map="11q11" gene 1..1549 /gene="Cldn14" /note="claudin 14" /db_xref="GeneID:304073" /db_xref="RGD:1309165" exon 1..400 /gene="Cldn14" /inference="alignment:Splign:2.1.0" exon 401..1416 /gene="Cldn14" /inference="alignment:Splign:2.1.0" misc_feature 436..438 /gene="Cldn14" /note="upstream in-frame stop codon" CDS 481..1200 /gene="Cldn14" /codon_start=1 /product="claudin-14" /protein_id="NP_001013447.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV"
misc_feature 547..1023 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
cagggaggtcagaaaaggctgacacaggacagtgagtaggaaaggtgaggtttcacctgccaggcacagggacccattagccagccgtgtgtagacatctctggcattcttgtatcaaatgcagatatgacatttctggttggtcttgaatgtttgcctcagcagggccaccttgtagggcgcaccagctagttaatcttctaaccagagggcatgtatgcccacgcaggccccactcagagaccgtaattgaccagaccactgtctcgcaagcaccctggccttgaagctcccatttggtgaatgaggctaagctggaagtcttcagtgtccttgctgtgtctccggggtctacctgcgtcggagtgtcgaggtggatgggactcgagctgttctgtatgcctcccgcgggcacctaaggaccagatccatccctgaggacctgggcactgcccggcgcggctagcggagccctcgaccatggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtgggaacgctcatcactactatcctgccgcactggcggaggacggcccatgtgggcaccaacatcctgacggccgtgtcctacctgaagggactgtggatggagtgtgtgtggcacagcacaggcatctaccagtgtcagatctaccgctcgctgctggcgctaccccgggacctacaggcggcccgggcgctcatggtcatctcctgcctgctgtcgggcatggcctgcgcctgcgccgtagtgggcatgaagtgcactcgctgtgccaagggcacacccgccaagaccaccttcgcggtgttgggaggcgcgctcttcctgctggcaggcctgctgtgcatggtggctgtgtcctggaccacgaatgatgtggtgcagaatttttacaaccctctgctgcccagtggcatgaagtttgagatcggccaggccctgtacctgggcttcatctcctcatccctgtctctcatcgggggcaccctgctctgcctgtcgtgccaggacgagggcccctacagaccctaccagccccagtccagggctggggccaccaccacagccaccgcccctgcctaccgcccaccagcagcctacaaggacaaccgtgccccctcggtgacctcagctgcacacagtgggtacaggttgaatgactatgtgtgagttccctccccaggcttctgccagggatgttgggccccaaaggaccagtgaaggatgtagagtcctttgtaaacgtggggaagtaagtctggaatacagggaagaagggtgctcttcaaagcaaagacttctaaaaagtgctggttttgtatttattatatgtatttatgtgggtggtttaataagagctcaataaagaatacttggaagattggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]