GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 22:05:12, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001007228            2850 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens speckle type BTB/POZ protein (SPOP), transcript
            variant 4, mRNA.
ACCESSION   NM_001007228
VERSION     NM_001007228.2
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2850)
  AUTHORS   Hernandez-Llodra S, Segales L, Safont A, Juanpere N, Lorenzo M,
            Fumado L, Rodriguez-Vida A, Cecchini L, Bellmunt J and
            Lloreta-Trull J.
  TITLE     SPOP and FOXA1 mutations are associated with PSA recurrence in ERG
            wt tumors, and SPOP downregulation with ERG-rearranged prostate
            cancer
  JOURNAL   Prostate 79 (10), 1156-1165 (2019)
   PUBMED   31090082
  REMARK    GeneRIF: In conclusion, SPOP and FOXA1 mutations may have
            prognostic value in ERG wt prostate tumors.
REFERENCE   2  (bases 1 to 2850)
  AUTHORS   Gang X, Xuan L, Zhao X, Lv Y, Li F, Wang Y and Wang G.
  TITLE     Speckle-type POZ protein suppresses lipid accumulation and prostate
            cancer growth by stabilizing fatty acid synthase
  JOURNAL   Prostate 79 (8), 864-871 (2019)
   PUBMED   30955223
  REMARK    GeneRIF: Data provide evidence that SPOP regulates lipid metabolism
            by decreasing FASN expression and FA synthesis, resulting in tumor
            suppression.
REFERENCE   3  (bases 1 to 2850)
  AUTHORS   Zhang J, Chen M, Zhu Y, Dai X, Dang F, Ren J, Ren S, Shulga YV,
            Beca F, Gan W, Wu F, Lin YM, Zhou X, DeCaprio JA, Beck AH, Lu KP,
            Huang J, Zhao C, Sun Y, Gao X, Pandolfi PP and Wei W.
  TITLE     SPOP Promotes Nanog Destruction to Suppress Stem Cell Traits and
            Prostate Cancer Progression
  JOURNAL   Dev. Cell 48 (3), 329-344 (2019)
   PUBMED   30595538
  REMARK    GeneRIF: cancer-derived mutations in SPOP or at the Nanog-degron
            (S68Y) disrupt SPOP-mediated destruction of Nanog, leading to
            elevated cancer stem cell traits and PrCa progression
REFERENCE   4  (bases 1 to 2850)
  AUTHORS   Fong KW, Zhao JC, Song B, Zheng B and Yu J.
  TITLE     TRIM28 protects TRIM24 from SPOP-mediated degradation and promotes
            prostate cancer progression
  JOURNAL   Nat Commun 9 (1), 5007 (2018)
   PUBMED   30479348
  REMARK    GeneRIF: TRIM24 and AR coactivated gene signature of SPOP-mutant
            prostate cancer (PCa) is similarly activated in human PCa with high
            TRIM28 expression.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2850)
  AUTHORS   Bouchard JJ, Otero JH, Scott DC, Szulc E, Martin EW, Sabri N,
            Granata D, Marzahn MR, Lindorff-Larsen K, Salvatella X, Schulman BA
            and Mittag T.
  TITLE     Cancer Mutations of the Tumor Suppressor SPOP Disrupt the Formation
            of Active, Phase-Separated Compartments
  JOURNAL   Mol. Cell 72 (1), 19-36 (2018)
   PUBMED   30244836
  REMARK    GeneRIF: Disease-associated SPOP mutations that lead to the
            accumulation of proto-oncogenic proteins interfere with phase
            separation and co-localization in membraneless organelles,
            suggesting that substrate-directed phase separation of this E3
            ligase underlies the regulation of ubiquitin-dependent proteostasis
REFERENCE   6  (bases 1 to 2850)
  AUTHORS   Diefenbach A, Tomasello E, Lucas M, Jamieson AM, Hsia JK, Vivier E
            and Raulet DH.
  TITLE     Selective associations with signaling proteins determine
            stimulatory versus costimulatory activity of NKG2D
  JOURNAL   Nat. Immunol. 3 (12), 1142-1149 (2002)
   PUBMED   12426565
  REMARK    Erratum:[Nat Immunol. 2004 Jun;5(6):658]
REFERENCE   7  (bases 1 to 2850)
  AUTHORS   Gilfillan S, Ho EL, Cella M, Yokoyama WM and Colonna M.
  TITLE     NKG2D recruits two distinct adapters to trigger NK cell activation
            and costimulation
  JOURNAL   Nat. Immunol. 3 (12), 1150-1155 (2002)
   PUBMED   12426564
REFERENCE   8  (bases 1 to 2850)
  AUTHORS   Zapata JM, Pawlowski K, Haas E, Ware CF, Godzik A and Reed JC.
  TITLE     A diverse family of proteins containing tumor necrosis factor
            receptor-associated factor domains
  JOURNAL   J. Biol. Chem. 276 (26), 24242-24252 (2001)
   PUBMED   11279055
REFERENCE   9  (bases 1 to 2850)
  AUTHORS   Wu J, Song Y, Bakker AB, Bauer S, Spies T, Lanier LL and Phillips
            JH.
  TITLE     An activating immunoreceptor complex formed by NKG2D and DAP10
  JOURNAL   Science 285 (5428), 730-732 (1999)
   PUBMED   10426994
REFERENCE   10 (bases 1 to 2850)
  AUTHORS   Nagai Y, Kojima T, Muro Y, Hachiya T, Nishizawa Y, Wakabayashi T
            and Hagiwara M.
  TITLE     Identification of a novel nuclear speckle-type protein, SPOP
  JOURNAL   FEBS Lett. 418 (1-2), 23-26 (1997)
   PUBMED   9414087
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BX282325.1, BC001269.1,
            AK123385.1, W84567.1, BM693397.1, BQ226031.1 and AW449169.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Nov 22, 2018 this sequence version replaced NM_001007228.1.
            
            Summary: This gene encodes a protein that may modulate the
            transcriptional repression activities of death-associated protein 6
            (DAXX), which interacts with histone deacetylase, core histones,
            and other histone-associated proteins. In mouse, the encoded
            protein binds to the putative leucine zipper domain of macroH2A1.2,
            a variant H2A histone that is enriched on inactivated X
            chromosomes. The BTB/POZ domain of this protein has been shown in
            other proteins to mediate transcriptional repression and to
            interact with components of histone deacetylase co-repressor
            complexes. Alternative splicing of this gene results in multiple
            transcript variants encoding the same protein. [provided by RefSeq,
            Jul 2008].
            
            Transcript Variant: This variant (4) differs in the 5' UTR compared
            to variant 1. Transcript variants 1-6 encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1660809.64717.1,
                                           SRR1803613.245200.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000504102.6/ ENSP00000425905.1
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-165               BX282325.1         67-231
            166-1716            BC001269.1         238-1788
            1717-1726           AK123385.1         1615-1624
            1727-1727           W84567.1           272-272
            1728-1728           BM693397.1         322-322
            1729-2237           AK123385.1         1625-2133
            2238-2450           BQ226031.1         245-457
            2451-2850           AW449169.1         16-415              c
FEATURES             Location/Qualifiers
     source          1..2850
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21.33"
     gene            1..2850
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="speckle type BTB/POZ protein"
                     /db_xref="GeneID:8405"
                     /db_xref="HGNC:HGNC:11254"
                     /db_xref="MIM:602650"
     exon            1..165
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       2
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:976068022"
     variation       4
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760495856"
     variation       5..8
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1381097604"
     variation       7
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1166621056"
     variation       8
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:972299000"
     variation       13..29
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggtgtgt"
                     /replace="ggtgtgtgtcggtgtgt"
                     /db_xref="dbSNP:1360110672"
     variation       14..41
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtcggtgtgtatgtgtgtgtgt"
                     /replace="gtgtgtgtcggtgtgtatgtgtgtgtgtcggtgtgtatgtgtgtgtgt
                     "
                     /db_xref="dbSNP:1491535538"
     variation       14
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:966308802"
     variation       22
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1390955610"
     variation       23
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1435855722"
     variation       24..29
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gt"
                     /replace="gtgtgt"
                     /db_xref="dbSNP:1567811374"
     variation       26
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:925596553"
     variation       29..31
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tat"
                     /db_xref="dbSNP:967098125"
     variation       30
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:912063943"
     variation       31..68
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tgtgtgtgt"
                     /replace="tgtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgt"
                     /db_xref="dbSNP:1401407332"
     variation       31..42
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tgtgtgtgtg"
                     /replace="tgtgtgtgtgtg"
                     /replace="tgtgtgtgtgtgtg"
                     /db_xref="dbSNP:752650296"
     variation       32..68
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtgt"
                     /replace="gtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgt"
                     /db_xref="dbSNP:1033156872"
     variation       32
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986334117"
     variation       34..67
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtg"
                     /replace="gtgtgtgtgagtgtgcgcgctccgagtgtgtgtg"
                     /db_xref="dbSNP:1355440883"
     variation       36
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1334539259"
     variation       40..46
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtg"
                     /replace="gtgagtg"
                     /db_xref="dbSNP:1192269966"
     variation       41
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:953554826"
     variation       44
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215848019"
     variation       50
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1490308364"
     variation       52
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1022381935"
     variation       55
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1011301564"
     variation       57
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418311826"
     variation       59..68
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgt"
                     /replace="gtgtgtgtgt"
                     /db_xref="dbSNP:1343720566"
     variation       59
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:956744998"
     variation       65
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474729775"
     variation       67
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030984031"
     variation       70
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:959856805"
     variation       80
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1034216945"
     variation       82
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355254424"
     variation       89
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413283945"
     variation       98
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183236673"
     variation       106
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:899103846"
     variation       119
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1003411727"
     variation       132
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282938263"
     variation       147
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1314544979"
     variation       151
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:906492670"
     variation       156
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211828659"
     variation       158
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1257730446"
     variation       159
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044841051"
     variation       161
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1012082736"
     variation       162
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:541995662"
     exon            166..309
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       174
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552678071"
     variation       176
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1303233302"
     variation       177
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:898358701"
     variation       186
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375760414"
     variation       187
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1004573148"
     variation       189
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770523866"
     variation       191
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748907854"
     variation       192
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200154697"
     variation       193
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747556061"
     variation       195..196
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:770983446"
     variation       195
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236595064"
     misc_feature    196..198
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="upstream in-frame stop codon"
     variation       196
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1211239574"
     variation       200
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:550262239"
     variation       203
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1485139008"
     variation       207
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283063006"
     variation       211
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369359417"
     variation       213
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:762810448"
     variation       215
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:746247721"
     variation       217
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779298365"
     variation       219
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369944128"
     variation       224
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:530576210"
     variation       230
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756180522"
     variation       231
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1445881208"
     CDS             232..1356
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="HIB homolog 1; roadkill homolog 1"
                     /codon_start=1
                     /product="speckle-type POZ protein"
                     /protein_id="NP_001007229.1"
                     /db_xref="CCDS:CCDS11551.1"
                     /db_xref="GeneID:8405"
                     /db_xref="HGNC:HGNC:11254"
                     /db_xref="MIM:602650"
                     /translation="
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS"
     misc_feature    313..729
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="Speckle-type POZ protein (SPOP) family, MATH
                     domain; composed of proteins with similarity to human
                     SPOP. SPOP was isolated as a novel antigen recognized by
                     serum from a scleroderma patient, whose overexpression in
                     COS cells results in a discrete speckled...; Region:
                     MATH_SPOP; cd03774"
                     /db_xref="CDD:239743"
     misc_feature    442..804
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Required for nuclear localization"
     misc_feature    order(490..492,619..627)
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239743"
     misc_feature    598..630
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for binding substrate proteins"
     misc_feature    775..1134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ
                     (poxvirus and zinc finger) domain found in speckle-type
                     POZ protein (SPOP) and similar proteins; Region:
                     BTB_POZ_SPOP-like; cd18279"
                     /db_xref="CDD:349588"
     misc_feature    787..882
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for homodimerization"
     misc_feature    1120..1332
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="BACK (BTB and C-terminal Kelch) domain found in
                     speckle-type POZ protein (SPOP); Region: BACK_SPOP;
                     cd18518"
                     /db_xref="CDD:350593"
     misc_feature    1120..1296
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for homodimerization"
     variation       244
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357465839"
     variation       256
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1176154786"
     variation       259
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752686914"
     variation       260
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767367200"
     variation       261
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:189212134"
     variation       264
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138762009"
     variation       270
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1410388458"
     variation       272
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412582124"
     variation       273
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150193528"
     variation       275
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033673807"
     variation       276
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375966583"
     variation       279
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747676565"
     variation       282
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:528362520"
     variation       283
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746338468"
     variation       291
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174659692"
     variation       300
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577150644"
     variation       303
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308493304"
     variation       306
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1289358875"
     exon            310..431
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       312
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:935757299"
     variation       315
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233295619"
     variation       330
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749665129"
     variation       342
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1172367957"
     variation       345
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436918312"
     variation       347
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201537546"
     variation       363
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778043495"
     variation       369
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1278407528"
     variation       397
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188095610"
     variation       399
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770032061"
     variation       405
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1264201283"
     variation       411
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748317501"
     variation       413
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781175213"
     variation       414
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254155223"
     variation       429
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249996971"
     exon            432..583
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       438
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006145755"
     variation       447
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:544086490"
     variation       456
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1251477344"
     variation       462
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047630305"
     variation       481
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780244378"
     variation       490
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1057519972"
     variation       491
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057519971"
     variation       495
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294614519"
     variation       496
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216697499"
     variation       523
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1233429922"
     variation       526
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866898949"
     variation       535
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519964"
     variation       536..549
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tcaaattctccatc"
                     /replace="tcaaattctccatcaaattctccatc"
                     /db_xref="dbSNP:1308009290"
     variation       536
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:193920894"
     variation       537
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519965"
     variation       561
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:878903236"
     variation       573
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758435270"
     variation       579
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1399114184"
     exon            584..711
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       597
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:910219777"
     variation       603
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367994374"
     variation       609
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777389504"
     variation       615
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464021387"
     variation       621
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239714436"
     variation       622
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519968"
     variation       623
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057519969"
     variation       624
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519970"
     variation       628
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519966"
     variation       629
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519967"
     variation       630
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:193921065"
     variation       635
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1006096444"
     variation       639
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755810590"
     variation       643
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968974699"
     variation       645
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888419251"
     variation       648
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:914728063"
     variation       654
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752320964"
     variation       659
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1369267775"
     variation       665
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113265648"
     variation       671
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186813947"
     variation       672
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767050824"
     variation       681
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1441922674"
     variation       702
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754476215"
     variation       705
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368288966"
     variation       708
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375093038"
     exon            712..889
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       717
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1484969675"
     variation       723
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747860563"
     variation       733
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1212007091"
     variation       734
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1204280245"
     variation       737
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437667184"
     variation       739
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260807436"
     variation       753
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271091972"
     variation       756
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1327381298"
     variation       758
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216583404"
     variation       764
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340081446"
     variation       771
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567773264"
     variation       777
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292730217"
     variation       782
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1476294846"
     variation       783
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780840574"
     variation       785
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200866660"
     variation       789
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754562658"
     variation       792
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944205508"
     variation       808
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568477610"
     variation       821
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866413895"
     variation       822
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:548343856"
     variation       823
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985933794"
     variation       824
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779385564"
     variation       829
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757833097"
     variation       838
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346246121"
     variation       840
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754270875"
     variation       842
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389640010"
     variation       843
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764587660"
     variation       844
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1475940002"
     variation       845
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1420633752"
     variation       847
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760936126"
     variation       849
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140932511"
     variation       852
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148282868"
     variation       853
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313171285"
     variation       866
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759790566"
     variation       870
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438582241"
     variation       873
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1272864182"
     variation       880
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211887878"
     exon            890..945
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       890
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753143058"
     variation       891
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1259088100"
     variation       892
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1484517050"
     variation       894
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1315023933"
     variation       899
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767942932"
     variation       900
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759885928"
     variation       909
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1567771033"
     variation       930
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1369992087"
     variation       931
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300720198"
     variation       933
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442685755"
     variation       934
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371025799"
     variation       936
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:933490114"
     variation       938
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428127345"
     variation       939
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1343939111"
     exon            946..1068
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       954
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1407495857"
     variation       960
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1170022058"
     variation       962
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369378549"
     variation       969
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546426832"
     variation       972
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766519919"
     variation       973
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567770650"
     variation       992
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1338311086"
     variation       993
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1042535989"
     variation       1005
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1279631023"
     variation       1010
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376811676"
     variation       1011
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1212744009"
     variation       1026
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485886229"
     variation       1029
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765280957"
     variation       1030
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868702285"
     variation       1034
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373610541"
     variation       1041
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776546524"
     variation       1051
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232195212"
     variation       1068
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355380144"
     exon            1069..1211
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1077
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1188835721"
     variation       1080
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747335231"
     variation       1084
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780421201"
     variation       1089
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758599151"
     variation       1103
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:937097664"
     variation       1106
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200147245"
     variation       1109
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1477707238"
     variation       1110
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765368825"
     variation       1115
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406463841"
     variation       1118
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:727502792"
     variation       1119
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757317825"
     variation       1120
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460928181"
     variation       1125
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146116174"
     variation       1126
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371674237"
     variation       1128..1129
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1567767320"
     variation       1134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142247620"
     variation       1137
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200881785"
     variation       1149
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767319726"
     variation       1152
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147619581"
     variation       1158
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113808176"
     variation       1159
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1399168977"
     variation       1171
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276142369"
     variation       1173
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770620764"
     variation       1176
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762562177"
     variation       1179
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567767288"
     variation       1180
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429805459"
     variation       1188
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148851634"
     variation       1192
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466718093"
     variation       1193
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274528044"
     variation       1204
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:890324763"
     variation       1205
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1209961119"
     exon            1212..2850
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1221
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160405402"
     variation       1247
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:907969016"
     variation       1249
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781763948"
     variation       1251
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445972010"
     variation       1257
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1198189256"
     variation       1258
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1030014457"
     variation       1259
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1261567055"
     variation       1269
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752649235"
     variation       1272
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567766372"
     variation       1287
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767281381"
     variation       1291
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759358719"
     variation       1292
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438495852"
     variation       1297
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751337978"
     variation       1302
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766130846"
     variation       1306
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762651623"
     variation       1311
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772900427"
     variation       1314
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275682069"
     variation       1316
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052158260"
     variation       1317
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769319131"
     variation       1324
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316085986"
     variation       1332
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1383872445"
     variation       1333
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761155742"
     variation       1334
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1380705599"
     variation       1335
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:776052725"
     variation       1339
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772401624"
     variation       1340
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235434281"
     variation       1347
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746238687"
     variation       1350
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172810936"
     variation       1353
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197356039"
     variation       1360..1361
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:767314540"
     variation       1360
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222554351"
     variation       1363
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779211010"
     variation       1366
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771163040"
     variation       1370
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749487561"
     variation       1379
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374401933"
     variation       1380
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114710735"
     variation       1396
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781198550"
     variation       1400
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1280919140"
     variation       1402
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562050616"
     variation       1404
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:974683092"
     variation       1411
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:957847034"
     variation       1425
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1175381073"
     variation       1432
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039276410"
     variation       1433
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414777422"
     variation       1434
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1378708366"
     variation       1436
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936518961"
     variation       1437
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562382565"
     variation       1440
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467377714"
     variation       1451..1454
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1442009162"
     variation       1454
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1332200541"
     variation       1455
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaa"
                     /db_xref="dbSNP:1376228588"
     variation       1457
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1042341294"
     variation       1460
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277074514"
     variation       1464
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368774705"
     variation       1467..1470
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1353270261"
     variation       1471
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:977971954"
     variation       1482
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946005147"
     variation       1485
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1282246105"
     variation       1486
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757895299"
     variation       1490
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966825580"
     variation       1498
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200124894"
     variation       1504
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1258198352"
     variation       1505
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1436683982"
     variation       1511
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024736466"
     variation       1513
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013198961"
     variation       1518
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:548845383"
     variation       1524
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:959068792"
     variation       1528
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405971501"
     variation       1529..1534
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1161792220"
     variation       1529
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1034543475"
     variation       1530
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1399680825"
     variation       1531
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1408226647"
     variation       1534
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001768556"
     variation       1543
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350906007"
     variation       1553
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1436380449"
     variation       1554
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111864010"
     variation       1560
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113925218"
     variation       1565
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381211799"
     variation       1566
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1038251848"
     variation       1574
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1480189223"
     variation       1577..1579
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1567766050"
     variation       1582
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752124955"
     variation       1590
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886488937"
     variation       1593
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111569143"
     variation       1597
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1291401520"
     variation       1599
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200436241"
     variation       1606..1609
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gg"
                     /replace="gggg"
                     /db_xref="dbSNP:373812698"
     variation       1606
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187597110"
     variation       1608
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759469033"
     variation       1609
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:963588932"
     variation       1610
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541437732"
     variation       1613
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933290334"
     variation       1618
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290360318"
     variation       1622
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219681525"
     variation       1624
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921956967"
     variation       1625
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764485328"
     variation       1626
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355391422"
     variation       1627..1628
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ata"
                     /db_xref="dbSNP:1223513413"
     variation       1627
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039066718"
     variation       1628
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:936549467"
     variation       1630
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925229462"
     variation       1631
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371658362"
     variation       1634
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474468457"
     variation       1637
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016902315"
     variation       1638
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978296694"
     variation       1643
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763258628"
     variation       1644
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140827537"
     variation       1645
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:565391290"
     variation       1647
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146448668"
     variation       1649
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362870075"
     variation       1652
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400932236"
     variation       1656
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959016638"
     variation       1677
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752911140"
     variation       1683
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:939909864"
     variation       1688
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325560884"
     variation       1693
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033276097"
     variation       1706
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365558763"
     variation       1709
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1301352164"
     variation       1715..1716
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1289440048"
     variation       1715
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199896895"
     variation       1716
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421665204"
     variation       1717..1728
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs5820770"
     variation       1727
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355597173"
     variation       1729
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:774692430"
     variation       1730..1732
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1345942108"
     variation       1734
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1158672009"
     variation       1735
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:995149163"
     variation       1747
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1029941160"
     variation       1755
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997174152"
     variation       1760..1761
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ttc"
                     /db_xref="dbSNP:1192747789"
     variation       1761
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444032460"
     variation       1775
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1162239264"
     variation       1776..1780
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1420836859"
     variation       1776
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900210620"
     variation       1782
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1158414122"
     variation       1788
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1383237120"
     variation       1789
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017361208"
     variation       1799
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:963925437"
     variation       1820
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340568991"
     variation       1830
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540124961"
     variation       1833
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:903701740"
     variation       1837
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765423323"
     variation       1845
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488989709"
     variation       1849
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1379107436"
     variation       1854
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016524104"
     variation       1859
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1005452858"
     variation       1865
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="ata"
                     /db_xref="dbSNP:1348236629"
     variation       1867
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202429883"
     variation       1873
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1279527989"
     variation       1878
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315466095"
     variation       1883
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281137740"
     variation       1885
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1240090018"
     variation       1886
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886635358"
     variation       1897
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224567259"
     variation       1900
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896436073"
     variation       1905
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11539921"
     variation       1907
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467852976"
     variation       1919
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:997572826"
     variation       1920..1927
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ttgtt"
                     /replace="ttgttgtt"
                     /db_xref="dbSNP:1044501333"
     variation       1922
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938699740"
     variation       1926
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927337779"
     variation       1927
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563879503"
     variation       1936
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942169671"
     variation       1946
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:556822256"
     variation       1956
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401857871"
     variation       1963
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536928211"
     variation       1964
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:909367277"
     variation       1976..1980
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1333781824"
     variation       1981
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574398448"
     variation       1984
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039016931"
     variation       1985..1992
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aag"
                     /replace="aagtgaag"
                     /db_xref="dbSNP:1323169779"
     variation       1987
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202188913"
     variation       2000..2006
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gg"
                     /replace="gggaagg"
                     /db_xref="dbSNP:1201987755"
     variation       2015
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:903762965"
     variation       2023
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:755339845"
     variation       2023
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775610764"
     variation       2027
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042349201"
     variation       2032
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945184221"
     variation       2034
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776756750"
     variation       2042
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917777067"
     variation       2055
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553459320"
     variation       2064
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937736180"
     variation       2065
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1429009380"
     variation       2067
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567765537"
     variation       2082
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020790901"
     variation       2083..2087
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aataa"
                     /db_xref="dbSNP:1451858319"
     variation       2106
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009440766"
     variation       2114
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061431"
     variation       2120
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1178306820"
     variation       2122
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470186280"
     variation       2132
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745885945"
     variation       2137
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1428435266"
     variation       2144
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1303589744"
     variation       2146
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1197209690"
     variation       2162
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344604697"
     variation       2170
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1221951157"
     variation       2173
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280288418"
     variation       2174
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056404854"
     variation       2175
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1226691732"
     variation       2188
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429727570"
     variation       2190
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261859092"
     variation       2194
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:879204747"
     variation       2195
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1489786536"
     variation       2200
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1484679592"
     variation       2204
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1238908405"
     variation       2205
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1204629523"
     variation       2206..2211
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1196864482"
     variation       2209..2219
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaacaaa"
                     /replace="aaacaaacaaa"
                     /db_xref="dbSNP:1323552367"
     variation       2212
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:878935173"
     variation       2213..2215
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:11372331"
     variation       2214..2215
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1425243840"
     variation       2215..2217
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1491244321"
     variation       2215
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1003259201"
     variation       2216
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:11316512"
     variation       2216
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:60764900"
     variation       2217..2227
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs112880999"
     variation       2217
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aga"
                     /db_xref="dbSNP:398031013"
     variation       2217
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201901446"
     variation       2218..2219
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1555571495"
     variation       2218..2219
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aacaa"
                     /db_xref="dbSNP:1555571496"
     variation       2218
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1555571494"
     variation       2218
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:551446310"
     variation       2219..2220
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:575037869"
     variation       2219
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:201572572"
     variation       2219
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:796515393"
     variation       2220
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3209120"
     variation       2225
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1264330844"
     variation       2226..2229
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaca"
                     /db_xref="dbSNP:1285439792"
     variation       2226..2227
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:976379703"
     variation       2226
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:923496110"
     variation       2227..2233
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="acaca"
                     /replace="acacaca"
                     /replace="acacacaca"
                     /db_xref="dbSNP:967786066"
     variation       2227
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaca"
                     /db_xref="dbSNP:1555571483"
     variation       2227
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:568696453"
     variation       2228
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1381296634"
     variation       2228
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1242922953"
     variation       2228
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548782643"
     variation       2229
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1316656577"
     variation       2231..2241
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="acaaaa"
                     /replace="acaaaacaaaa"
                     /db_xref="dbSNP:1442760457"
     variation       2233..2236
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1483947116"
     variation       2237
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183744712"
     variation       2240
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020720602"
     variation       2249..2255
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaaagaa"
                     /db_xref="dbSNP:752361093"
     variation       2256
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294918681"
     variation       2258
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1408482286"
     variation       2260
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418240665"
     variation       2261..2262
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1157213963"
     variation       2263
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:973675289"
     variation       2266
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009370366"
     variation       2276
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336216845"
     variation       2288
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:960544858"
     variation       2299
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:978660984"
     variation       2301
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381612365"
     variation       2309
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962439117"
     variation       2312
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280596115"
     variation       2313
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:529125953"
     variation       2317
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222352977"
     variation       2328
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1002108724"
     variation       2338
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560399952"
     variation       2339
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866964250"
     variation       2342
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1262011874"
     variation       2347
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459561137"
     variation       2349
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951048440"
     variation       2352
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405116339"
     variation       2353
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233331053"
     variation       2355
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1174134341"
     variation       2375
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463435802"
     variation       2376
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030481712"
     variation       2380
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022959218"
     variation       2382
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997687342"
     variation       2383
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1169125351"
     variation       2388
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183140947"
     variation       2389..2392
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:35992798"
     variation       2392
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1047814736"
     variation       2394
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929452184"
     variation       2404
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467194776"
     variation       2405..2417
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tgttaattttttt"
                     /db_xref="dbSNP:1040970423"
     variation       2411..2423
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /replace="ttttttttttttt"
                     /replace="tttttttttttttt"
                     /db_xref="dbSNP:59034311"
     variation       2411
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330147545"
     variation       2412
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:902001912"
     variation       2424
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1346510700"
     variation       2426
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461116499"
     variation       2429
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223784509"
     variation       2433
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282193301"
     variation       2441
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774306822"
     variation       2443
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768452774"
     variation       2457
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001273033"
     variation       2458
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481239034"
     variation       2465
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903878933"
     variation       2474
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1270817693"
     variation       2500
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946374543"
     variation       2502
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:913627726"
     variation       2510
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225249717"
     variation       2515
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:556635462"
     variation       2536
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042683582"
     variation       2555..2556
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1476508938"
     variation       2579
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945283137"
     variation       2580
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:960470057"
     variation       2582
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1245567520"
     variation       2584
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1034847989"
     variation       2592
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:896422662"
     variation       2599
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:527677909"
     variation       2601
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:535935117"
     variation       2603
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1380911108"
     variation       2610
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432431503"
     variation       2611
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270309265"
     variation       2619
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:981047533"
     variation       2625
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1212755937"
     variation       2626
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293777849"
     variation       2627
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359890603"
     variation       2631
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221550664"
     variation       2635
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:969330114"
     variation       2640
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1334428012"
     variation       2646
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1241629516"
     variation       2647..2657
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tg"
                     /replace="tgtcctccctg"
                     /db_xref="dbSNP:1397035963"
     variation       2648
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937853846"
     variation       2651
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145386680"
     variation       2653
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1386333270"
     variation       2659
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1424580546"
     variation       2669
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297548419"
     variation       2670
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1459980916"
     variation       2671
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162128235"
     variation       2672
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386591655"
     variation       2679
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163709382"
     variation       2695
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006148452"
     variation       2697
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:887796694"
     variation       2698
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1325359629"
     variation       2699
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427954982"
     variation       2700
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026296647"
     variation       2703
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1383506634"
     variation       2710
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1443605907"
     variation       2717
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:531874228"
     variation       2721
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993529456"
     variation       2740..2745
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1445358431"
     variation       2745
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:973888146"
     variation       2746
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:941012352"
     variation       2750
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383062186"
     variation       2773
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184423572"
     variation       2775
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1444604568"
     variation       2792
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1420054557"
     variation       2801
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:116782699"
     variation       2810
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74441281"
     variation       2815
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044384839"
     variation       2816
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:946343523"
     variation       2824
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1455301779"
     variation       2827
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:950958016"
     variation       2829
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1338187205"
     variation       2834
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406140312"
     variation       2836
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451871368"
     variation       2845
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:913554405"
ORIGIN      
gacgccccggctggtgtgtgtcggtgtgtatgtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgtatttgtgtatcggcggtcccgcaggtcccggatgttgcggacagtatgaggcaagcgcagggggacggggaccagcagctgtcgccgccgctctcagggtgaagagggaacagaaatctttgccccctgactttggaaatctcgtttaaccttcaaactggcgatgtcaagggttccaagtcctccacctccggcagaaatgtcgagtggccccgtagctgagagttggtgctacacacagatcaaggtagtgaaattctcctacatgtggaccatcaataactttagcttttgccgggaggaaatgggtgaagtcattaaaagttctacattttcatcaggagcaaatgataaactgaaatggtgtttgcgagtaaaccccaaagggttagatgaagaaagcaaagattacctgtcactttacctgttactggtcagctgtccaaagagtgaagttcgggcaaaattcaaattctccatcctgaatgccaagggagaagaaaccaaagctatggagagtcaacgggcatataggtttgtgcaaggcaaagactggggattcaagaaattcatccgtagagattttcttttggatgaggccaacgggcttctccctgatgacaagcttaccctcttctgcgaggtgagtgttgtgcaagattctgtcaacatttctggccagaataccatgaacatggtaaaggttcctgagtgccggctggcagatgagttaggaggactgtgggagaattcccggttcacagactgctgcttgtgtgttgccggccaggaattccaggctcacaaggctatcttagcagctcgttctccggtttttagtgccatgtttgaacatgaaatggaggagagcaaaaagaatcgagttgaaatcaatgatgtggagcctgaagtttttaaggaaatgatgtgcttcatttacacggggaaggctccaaacctcgacaaaatggctgatgatttgctggcagctgctgacaagtatgccctggagcgcttaaaggtcatgtgtgaggatgccctctgcagtaacctgtccgtggagaacgctgcagaaattctcatcctggccgacctccacagtgcagatcagttgaaaactcaggcagtggatttcatcaactatcatgcttcggatgtcttggagacctctgggtggaagtcaatggtggtgtcacatccccacttggtggctgaggcataccgctctctggcttcagcacagtgcccttttctgggacccccacgcaaacgcctgaagcaatcctaagatcctgcttgttgtaagactccgtttaatttccagaagcagcagccactgttgctgccactgaccaccaggtagacagcgcaatctgtggagcttttactctgttgtgaggggaagagactgcattgtggccccagacttttaaaacagcactaaataacttgggggaaacggggggagggaaaatgaaatgaaaaccctgttgctgcgtcactgtgttccctttggcctggctgagtttgatactgtggggattcagtttaggcgctggcccgaggatatcccagcggtggtacttcggagacacctgtctgcatctgactgagcagaacaaatcgtcaggtgcctggagcaaaaaggaaaaaaaaaaaagaaaggacattgagttttaacagaagggaaaaggaaagaagaaaagatttttgcagaatttctcaaaaatcagtttgtggattccagtagtatttatattgagagaaacaaattttagtccttctaactgtgctaaaacttggatatttgtgaaaactccttaccaccatacaagcatcagaagagctctcttgttgttagcacttattgtttgcaagaacagaatacatccttttatccttttatgaaaaatgacaagtgaaggcaaaaggggaaggttatttgatctggaagatgagtgttctgatgtggtggcttttgcaaaaatctttattggtgttgaaaactggaaaaaataactcatccagaattcatattgtcttgacaagaactatggttctctgtttttagatattgtggaaaatgtttttgggcatttttctctgattttatttcttctcccccacccctttttctaaaaaacaaacaaaaaaaaaaacacacaaaacaaaaacagaacaaaagaagagagaaggaaattttatcaattaaaaatgctgtgtgataaaatcccagcccagattgctcagctgtttgtacctgacttgccgcctgcataggagccagttctgttccttctgactagcccctcttcctccaggggagaacttccaaatgttaatttttttttttttgaaaatataaataattactattttgtactgtgtggtatctctggtcttttgtttcactcacctgccttgtctcttgggtctgagtcccttgcttaagggattttgaagtcctagttttcagcttgcagagattatgtctgaaatgcctaatgagtcgcagggatttgttgagactccgtaatctcaagttctctttgtgagctatcagcatctgccagtctcttgtcctccctgagtatctcacagtccatatcctgatgagggatcaggcccctacctctgccaaggcaagtaatggtagtgggcttttaaactgccccccgtatgttttaagacctaatccccacctcccttcttctaactaaatataaaaagatccaggggacataaatgtggagattaaataaagggaaattattgtctctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]