GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 11:35:11, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001007227            2983 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens speckle type BTB/POZ protein (SPOP), transcript
            variant 3, mRNA.
ACCESSION   NM_001007227
VERSION     NM_001007227.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2983)
  AUTHORS   Hernandez-Llodra S, Segales L, Safont A, Juanpere N, Lorenzo M,
            Fumado L, Rodriguez-Vida A, Cecchini L, Bellmunt J and
            Lloreta-Trull J.
  TITLE     SPOP and FOXA1 mutations are associated with PSA recurrence in ERG
            wt tumors, and SPOP downregulation with ERG-rearranged prostate
            cancer
  JOURNAL   Prostate 79 (10), 1156-1165 (2019)
   PUBMED   31090082
  REMARK    GeneRIF: In conclusion, SPOP and FOXA1 mutations may have
            prognostic value in ERG wt prostate tumors.
REFERENCE   2  (bases 1 to 2983)
  AUTHORS   Gang X, Xuan L, Zhao X, Lv Y, Li F, Wang Y and Wang G.
  TITLE     Speckle-type POZ protein suppresses lipid accumulation and prostate
            cancer growth by stabilizing fatty acid synthase
  JOURNAL   Prostate 79 (8), 864-871 (2019)
   PUBMED   30955223
  REMARK    GeneRIF: Data provide evidence that SPOP regulates lipid metabolism
            by decreasing FASN expression and FA synthesis, resulting in tumor
            suppression.
REFERENCE   3  (bases 1 to 2983)
  AUTHORS   Zhang J, Chen M, Zhu Y, Dai X, Dang F, Ren J, Ren S, Shulga YV,
            Beca F, Gan W, Wu F, Lin YM, Zhou X, DeCaprio JA, Beck AH, Lu KP,
            Huang J, Zhao C, Sun Y, Gao X, Pandolfi PP and Wei W.
  TITLE     SPOP Promotes Nanog Destruction to Suppress Stem Cell Traits and
            Prostate Cancer Progression
  JOURNAL   Dev. Cell 48 (3), 329-344 (2019)
   PUBMED   30595538
  REMARK    GeneRIF: cancer-derived mutations in SPOP or at the Nanog-degron
            (S68Y) disrupt SPOP-mediated destruction of Nanog, leading to
            elevated cancer stem cell traits and PrCa progression
REFERENCE   4  (bases 1 to 2983)
  AUTHORS   Fong KW, Zhao JC, Song B, Zheng B and Yu J.
  TITLE     TRIM28 protects TRIM24 from SPOP-mediated degradation and promotes
            prostate cancer progression
  JOURNAL   Nat Commun 9 (1), 5007 (2018)
   PUBMED   30479348
  REMARK    GeneRIF: TRIM24 and AR coactivated gene signature of SPOP-mutant
            prostate cancer (PCa) is similarly activated in human PCa with high
            TRIM28 expression.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2983)
  AUTHORS   Bouchard JJ, Otero JH, Scott DC, Szulc E, Martin EW, Sabri N,
            Granata D, Marzahn MR, Lindorff-Larsen K, Salvatella X, Schulman BA
            and Mittag T.
  TITLE     Cancer Mutations of the Tumor Suppressor SPOP Disrupt the Formation
            of Active, Phase-Separated Compartments
  JOURNAL   Mol. Cell 72 (1), 19-36 (2018)
   PUBMED   30244836
  REMARK    GeneRIF: Disease-associated SPOP mutations that lead to the
            accumulation of proto-oncogenic proteins interfere with phase
            separation and co-localization in membraneless organelles,
            suggesting that substrate-directed phase separation of this E3
            ligase underlies the regulation of ubiquitin-dependent proteostasis
REFERENCE   6  (bases 1 to 2983)
  AUTHORS   Diefenbach A, Tomasello E, Lucas M, Jamieson AM, Hsia JK, Vivier E
            and Raulet DH.
  TITLE     Selective associations with signaling proteins determine
            stimulatory versus costimulatory activity of NKG2D
  JOURNAL   Nat. Immunol. 3 (12), 1142-1149 (2002)
   PUBMED   12426565
  REMARK    Erratum:[Nat Immunol. 2004 Jun;5(6):658]
REFERENCE   7  (bases 1 to 2983)
  AUTHORS   Gilfillan S, Ho EL, Cella M, Yokoyama WM and Colonna M.
  TITLE     NKG2D recruits two distinct adapters to trigger NK cell activation
            and costimulation
  JOURNAL   Nat. Immunol. 3 (12), 1150-1155 (2002)
   PUBMED   12426564
REFERENCE   8  (bases 1 to 2983)
  AUTHORS   Zapata JM, Pawlowski K, Haas E, Ware CF, Godzik A and Reed JC.
  TITLE     A diverse family of proteins containing tumor necrosis factor
            receptor-associated factor domains
  JOURNAL   J. Biol. Chem. 276 (26), 24242-24252 (2001)
   PUBMED   11279055
REFERENCE   9  (bases 1 to 2983)
  AUTHORS   Wu J, Song Y, Bakker AB, Bauer S, Spies T, Lanier LL and Phillips
            JH.
  TITLE     An activating immunoreceptor complex formed by NKG2D and DAP10
  JOURNAL   Science 285 (5428), 730-732 (1999)
   PUBMED   10426994
REFERENCE   10 (bases 1 to 2983)
  AUTHORS   Nagai Y, Kojima T, Muro Y, Hachiya T, Nishizawa Y, Wakabayashi T
            and Hagiwara M.
  TITLE     Identification of a novel nuclear speckle-type protein, SPOP
  JOURNAL   FEBS Lett. 418 (1-2), 23-26 (1997)
   PUBMED   9414087
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BX282325.1, BC001269.1,
            AK123385.1, W84567.1, BM693397.1, BQ226031.1 and AW449169.1.
            
            Summary: This gene encodes a protein that may modulate the
            transcriptional repression activities of death-associated protein 6
            (DAXX), which interacts with histone deacetylase, core histones,
            and other histone-associated proteins. In mouse, the encoded
            protein binds to the putative leucine zipper domain of macroH2A1.2,
            a variant H2A histone that is enriched on inactivated X
            chromosomes. The BTB/POZ domain of this protein has been shown in
            other proteins to mediate transcriptional repression and to
            interact with components of histone deacetylase co-repressor
            complexes. Alternative splicing of this gene results in multiple
            transcript variants encoding the same protein. [provided by RefSeq,
            Jul 2008].
            
            Transcript Variant: This variant (3) differs in the 5' UTR compared
            to variant 1.  Transcript variants 1-6 encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1660805.182482.1,
                                           SRR1803613.55647.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-231               BX282325.1         1-231
            232-283             BX282325.1         354-405
            284-1834            BC001269.1         238-1788
            1835-1844           AK123385.1         1615-1624
            1845-1845           W84567.1           272-272
            1846-1846           BM693397.1         322-322
            1847-2355           AK123385.1         1625-2133
            2356-2568           BQ226031.1         245-457
            2569-2983           AW449169.1         1-415               c
FEATURES             Location/Qualifiers
     source          1..2983
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21.33"
     gene            1..2983
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="speckle type BTB/POZ protein"
                     /db_xref="GeneID:8405"
                     /db_xref="HGNC:HGNC:11254"
                     /db_xref="MIM:602650"
     exon            1..231
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309372632"
     variation       4
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895708523"
     variation       7
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1003444226"
     variation       8
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168759001"
     variation       11
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1390266268"
     variation       12
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:564104381"
     variation       13
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295190272"
     variation       16
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1198254534"
     variation       18
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001496705"
     variation       21
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:550960544"
     variation       22
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947786168"
     variation       23
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1038399438"
     variation       25
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1364725267"
     variation       27
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1367703177"
     variation       28
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:530858573"
     variation       38
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1048493666"
     variation       40
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1047187388"
     variation       44
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934167539"
     variation       46
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1266599200"
     variation       48
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922819317"
     variation       49
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:929674863"
     variation       54
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1212601670"
     variation       55
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1250608141"
     variation       60
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1450726394"
     variation       61
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1186761388"
     variation       68
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:976068022"
     variation       70
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760495856"
     variation       71..74
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1381097604"
     variation       73
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1166621056"
     variation       74
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:972299000"
     variation       79..95
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggtgtgt"
                     /replace="ggtgtgtgtcggtgtgt"
                     /db_xref="dbSNP:1360110672"
     variation       80..107
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtcggtgtgtatgtgtgtgtgt"
                     /replace="gtgtgtgtcggtgtgtatgtgtgtgtgtcggtgtgtatgtgtgtgtgt
                     "
                     /db_xref="dbSNP:1491535538"
     variation       80
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:966308802"
     variation       88
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1390955610"
     variation       89
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1435855722"
     variation       90..95
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gt"
                     /replace="gtgtgt"
                     /db_xref="dbSNP:1567811374"
     variation       92
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:925596553"
     variation       95..97
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tat"
                     /db_xref="dbSNP:967098125"
     variation       96
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:912063943"
     variation       97..134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tgtgtgtgt"
                     /replace="tgtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgt"
                     /db_xref="dbSNP:1401407332"
     variation       97..108
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tgtgtgtgtg"
                     /replace="tgtgtgtgtgtg"
                     /replace="tgtgtgtgtgtgtg"
                     /db_xref="dbSNP:752650296"
     variation       98..134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtgt"
                     /replace="gtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgt"
                     /db_xref="dbSNP:1033156872"
     variation       98
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986334117"
     variation       100..133
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtg"
                     /replace="gtgtgtgtgagtgtgcgcgctccgagtgtgtgtg"
                     /db_xref="dbSNP:1355440883"
     variation       102
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1334539259"
     variation       106..112
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtg"
                     /replace="gtgagtg"
                     /db_xref="dbSNP:1192269966"
     variation       107
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:953554826"
     variation       110
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215848019"
     variation       116
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1490308364"
     variation       118
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1022381935"
     variation       121
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1011301564"
     variation       123
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418311826"
     variation       125..134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgt"
                     /replace="gtgtgtgtgt"
                     /db_xref="dbSNP:1343720566"
     variation       125
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:956744998"
     variation       131
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474729775"
     variation       133
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030984031"
     variation       136
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:959856805"
     variation       146
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1034216945"
     variation       148
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355254424"
     variation       155
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413283945"
     variation       164
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183236673"
     variation       172
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:899103846"
     variation       185
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1003411727"
     variation       198
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282938263"
     variation       213
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1314544979"
     variation       217
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:906492670"
     variation       222
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211828659"
     variation       224
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1257730446"
     variation       225
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044841051"
     variation       227
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1012082736"
     variation       228
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:541995662"
     exon            232..283
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       235
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567805450"
     variation       242
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:566036539"
     variation       243
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204569527"
     variation       245
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056714551"
     variation       247
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1306445065"
     variation       266
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:552677165"
     variation       270
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1270385564"
     variation       275
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766527856"
     variation       277
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457918485"
     exon            284..427
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       292
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552678071"
     variation       294
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1303233302"
     variation       295
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:898358701"
     variation       304
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375760414"
     variation       305
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1004573148"
     variation       307
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770523866"
     variation       309
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748907854"
     variation       310
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200154697"
     variation       311
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747556061"
     variation       313..314
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:770983446"
     variation       313
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236595064"
     misc_feature    314..316
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="upstream in-frame stop codon"
     variation       314
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1211239574"
     variation       318
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:550262239"
     variation       321
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1485139008"
     variation       325
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283063006"
     variation       329
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369359417"
     variation       331
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:762810448"
     variation       333
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:746247721"
     variation       335
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779298365"
     variation       337
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369944128"
     variation       342
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:530576210"
     variation       348
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756180522"
     variation       349
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1445881208"
     CDS             350..1474
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="HIB homolog 1; roadkill homolog 1"
                     /codon_start=1
                     /product="speckle-type POZ protein"
                     /protein_id="NP_001007228.1"
                     /db_xref="CCDS:CCDS11551.1"
                     /db_xref="GeneID:8405"
                     /db_xref="HGNC:HGNC:11254"
                     /db_xref="MIM:602650"
                     /translation="
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS"
     misc_feature    431..847
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="Speckle-type POZ protein (SPOP) family, MATH
                     domain; composed of proteins with similarity to human
                     SPOP. SPOP was isolated as a novel antigen recognized by
                     serum from a scleroderma patient, whose overexpression in
                     COS cells results in a discrete speckled...; Region:
                     MATH_SPOP; cd03774"
                     /db_xref="CDD:239743"
     misc_feature    560..922
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Required for nuclear localization"
     misc_feature    order(608..610,737..745)
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239743"
     misc_feature    716..748
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for binding substrate proteins"
     misc_feature    893..1252
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ
                     (poxvirus and zinc finger) domain found in speckle-type
                     POZ protein (SPOP) and similar proteins; Region:
                     BTB_POZ_SPOP-like; cd18279"
                     /db_xref="CDD:349588"
     misc_feature    905..1000
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for homodimerization"
     misc_feature    1238..1450
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="BACK (BTB and C-terminal Kelch) domain found in
                     speckle-type POZ protein (SPOP); Region: BACK_SPOP;
                     cd18518"
                     /db_xref="CDD:350593"
     misc_feature    1238..1414
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for homodimerization"
     variation       362
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357465839"
     variation       374
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1176154786"
     variation       377
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752686914"
     variation       378
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767367200"
     variation       379
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:189212134"
     variation       382
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138762009"
     variation       388
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1410388458"
     variation       390
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412582124"
     variation       391
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150193528"
     variation       393
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033673807"
     variation       394
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375966583"
     variation       397
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747676565"
     variation       400
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:528362520"
     variation       401
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746338468"
     variation       409
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174659692"
     variation       418
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577150644"
     variation       421
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308493304"
     variation       424
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1289358875"
     exon            428..549
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       430
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:935757299"
     variation       433
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233295619"
     variation       448
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749665129"
     variation       460
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1172367957"
     variation       463
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436918312"
     variation       465
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201537546"
     variation       481
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778043495"
     variation       487
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1278407528"
     variation       515
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188095610"
     variation       517
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770032061"
     variation       523
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1264201283"
     variation       529
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748317501"
     variation       531
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781175213"
     variation       532
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254155223"
     variation       547
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249996971"
     exon            550..701
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       556
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006145755"
     variation       565
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:544086490"
     variation       574
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1251477344"
     variation       580
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047630305"
     variation       599
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780244378"
     variation       608
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1057519972"
     variation       609
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057519971"
     variation       613
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294614519"
     variation       614
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216697499"
     variation       641
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1233429922"
     variation       644
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866898949"
     variation       653
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519964"
     variation       654..667
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tcaaattctccatc"
                     /replace="tcaaattctccatcaaattctccatc"
                     /db_xref="dbSNP:1308009290"
     variation       654
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:193920894"
     variation       655
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519965"
     variation       679
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:878903236"
     variation       691
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758435270"
     variation       697
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1399114184"
     exon            702..829
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       715
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:910219777"
     variation       721
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367994374"
     variation       727
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777389504"
     variation       733
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464021387"
     variation       739
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239714436"
     variation       740
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519968"
     variation       741
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057519969"
     variation       742
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519970"
     variation       746
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519966"
     variation       747
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519967"
     variation       748
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:193921065"
     variation       753
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1006096444"
     variation       757
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755810590"
     variation       761
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968974699"
     variation       763
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888419251"
     variation       766
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:914728063"
     variation       772
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752320964"
     variation       777
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1369267775"
     variation       783
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113265648"
     variation       789
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186813947"
     variation       790
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767050824"
     variation       799
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1441922674"
     variation       820
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754476215"
     variation       823
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368288966"
     variation       826
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375093038"
     exon            830..1007
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       835
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1484969675"
     variation       841
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747860563"
     variation       851
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1212007091"
     variation       852
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1204280245"
     variation       855
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437667184"
     variation       857
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260807436"
     variation       871
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271091972"
     variation       874
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1327381298"
     variation       876
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216583404"
     variation       882
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340081446"
     variation       889
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567773264"
     variation       895
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292730217"
     variation       900
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1476294846"
     variation       901
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780840574"
     variation       903
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200866660"
     variation       907
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754562658"
     variation       910
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944205508"
     variation       926
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568477610"
     variation       939
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866413895"
     variation       940
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:548343856"
     variation       941
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985933794"
     variation       942
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779385564"
     variation       947
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757833097"
     variation       956
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346246121"
     variation       958
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754270875"
     variation       960
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389640010"
     variation       961
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764587660"
     variation       962
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1475940002"
     variation       963
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1420633752"
     variation       965
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760936126"
     variation       967
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140932511"
     variation       970
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148282868"
     variation       971
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313171285"
     variation       984
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759790566"
     variation       988
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438582241"
     variation       991
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1272864182"
     variation       998
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211887878"
     exon            1008..1063
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1008
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753143058"
     variation       1009
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1259088100"
     variation       1010
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1484517050"
     variation       1012
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1315023933"
     variation       1017
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767942932"
     variation       1018
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759885928"
     variation       1027
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1567771033"
     variation       1048
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1369992087"
     variation       1049
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300720198"
     variation       1051
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442685755"
     variation       1052
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371025799"
     variation       1054
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:933490114"
     variation       1056
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428127345"
     variation       1057
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1343939111"
     exon            1064..1186
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1072
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1407495857"
     variation       1078
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1170022058"
     variation       1080
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369378549"
     variation       1087
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546426832"
     variation       1090
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766519919"
     variation       1091
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567770650"
     variation       1110
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1338311086"
     variation       1111
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1042535989"
     variation       1123
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1279631023"
     variation       1128
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376811676"
     variation       1129
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1212744009"
     variation       1144
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485886229"
     variation       1147
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765280957"
     variation       1148
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868702285"
     variation       1152
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373610541"
     variation       1159
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776546524"
     variation       1169
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232195212"
     variation       1186
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355380144"
     exon            1187..1329
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1195
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1188835721"
     variation       1198
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747335231"
     variation       1202
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780421201"
     variation       1207
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758599151"
     variation       1221
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:937097664"
     variation       1224
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200147245"
     variation       1227
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1477707238"
     variation       1228
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765368825"
     variation       1233
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406463841"
     variation       1236
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:727502792"
     variation       1237
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757317825"
     variation       1238
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460928181"
     variation       1243
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146116174"
     variation       1244
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371674237"
     variation       1246..1247
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1567767320"
     variation       1252
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142247620"
     variation       1255
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200881785"
     variation       1267
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767319726"
     variation       1270
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147619581"
     variation       1276
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113808176"
     variation       1277
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1399168977"
     variation       1289
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276142369"
     variation       1291
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770620764"
     variation       1294
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762562177"
     variation       1297
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567767288"
     variation       1298
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429805459"
     variation       1306
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148851634"
     variation       1310
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466718093"
     variation       1311
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274528044"
     variation       1322
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:890324763"
     variation       1323
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1209961119"
     exon            1330..2968
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1339
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160405402"
     variation       1365
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:907969016"
     variation       1367
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781763948"
     variation       1369
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445972010"
     variation       1375
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1198189256"
     variation       1376
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1030014457"
     variation       1377
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1261567055"
     variation       1387
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752649235"
     variation       1390
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567766372"
     variation       1405
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767281381"
     variation       1409
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759358719"
     variation       1410
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438495852"
     variation       1415
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751337978"
     variation       1420
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766130846"
     variation       1424
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762651623"
     variation       1429
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772900427"
     variation       1432
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275682069"
     variation       1434
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052158260"
     variation       1435
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769319131"
     variation       1442
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316085986"
     variation       1450
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1383872445"
     variation       1451
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761155742"
     variation       1452
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1380705599"
     variation       1453
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:776052725"
     variation       1457
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772401624"
     variation       1458
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235434281"
     variation       1465
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746238687"
     variation       1468
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172810936"
     variation       1471
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197356039"
     variation       1478..1479
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:767314540"
     variation       1478
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222554351"
     variation       1481
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779211010"
     variation       1484
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771163040"
     variation       1488
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749487561"
     variation       1497
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374401933"
     variation       1498
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114710735"
     variation       1514
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781198550"
     variation       1518
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1280919140"
     variation       1520
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562050616"
     variation       1522
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:974683092"
     variation       1529
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:957847034"
     variation       1543
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1175381073"
     variation       1550
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039276410"
     variation       1551
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414777422"
     variation       1552
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1378708366"
     variation       1554
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936518961"
     variation       1555
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562382565"
     variation       1558
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467377714"
     variation       1569..1572
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1442009162"
     variation       1572
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1332200541"
     variation       1573
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaa"
                     /db_xref="dbSNP:1376228588"
     variation       1575
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1042341294"
     variation       1578
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277074514"
     variation       1582
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368774705"
     variation       1585..1588
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1353270261"
     variation       1589
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:977971954"
     variation       1600
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946005147"
     variation       1603
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1282246105"
     variation       1604
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757895299"
     variation       1608
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966825580"
     variation       1616
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200124894"
     variation       1622
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1258198352"
     variation       1623
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1436683982"
     variation       1629
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024736466"
     variation       1631
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013198961"
     variation       1636
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:548845383"
     variation       1642
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:959068792"
     variation       1646
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405971501"
     variation       1647..1652
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1161792220"
     variation       1647
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1034543475"
     variation       1648
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1399680825"
     variation       1649
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1408226647"
     variation       1652
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001768556"
     variation       1661
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350906007"
     variation       1671
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1436380449"
     variation       1672
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111864010"
     variation       1678
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113925218"
     variation       1683
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381211799"
     variation       1684
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1038251848"
     variation       1692
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1480189223"
     variation       1695..1697
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1567766050"
     variation       1700
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752124955"
     variation       1708
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886488937"
     variation       1711
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111569143"
     variation       1715
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1291401520"
     variation       1717
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200436241"
     variation       1724..1727
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gg"
                     /replace="gggg"
                     /db_xref="dbSNP:373812698"
     variation       1724
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187597110"
     variation       1726
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759469033"
     variation       1727
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:963588932"
     variation       1728
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541437732"
     variation       1731
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933290334"
     variation       1736
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290360318"
     variation       1740
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219681525"
     variation       1742
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921956967"
     variation       1743
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764485328"
     variation       1744
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355391422"
     variation       1745..1746
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ata"
                     /db_xref="dbSNP:1223513413"
     variation       1745
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039066718"
     variation       1746
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:936549467"
     variation       1748
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925229462"
     variation       1749
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371658362"
     variation       1752
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474468457"
     variation       1755
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016902315"
     variation       1756
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978296694"
     variation       1761
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763258628"
     variation       1762
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140827537"
     variation       1763
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:565391290"
     variation       1765
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146448668"
     variation       1767
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362870075"
     variation       1770
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400932236"
     variation       1774
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959016638"
     variation       1795
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752911140"
     variation       1801
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:939909864"
     variation       1806
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325560884"
     variation       1811
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033276097"
     variation       1824
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365558763"
     variation       1827
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1301352164"
     variation       1833..1834
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1289440048"
     variation       1833
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199896895"
     variation       1834
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421665204"
     variation       1835..1846
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs5820770"
     variation       1845
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355597173"
     variation       1847
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:774692430"
     variation       1848..1850
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1345942108"
     variation       1852
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1158672009"
     variation       1853
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:995149163"
     variation       1865
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1029941160"
     variation       1873
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997174152"
     variation       1878..1879
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ttc"
                     /db_xref="dbSNP:1192747789"
     variation       1879
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444032460"
     variation       1893
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1162239264"
     variation       1894..1898
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1420836859"
     variation       1894
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900210620"
     variation       1900
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1158414122"
     variation       1906
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1383237120"
     variation       1907
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017361208"
     variation       1917
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:963925437"
     variation       1938
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340568991"
     variation       1948
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540124961"
     variation       1951
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:903701740"
     variation       1955
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765423323"
     variation       1963
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488989709"
     variation       1967
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1379107436"
     variation       1972
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016524104"
     variation       1977
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1005452858"
     variation       1983
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="ata"
                     /db_xref="dbSNP:1348236629"
     variation       1985
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202429883"
     variation       1991
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1279527989"
     variation       1996
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315466095"
     variation       2001
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281137740"
     variation       2003
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1240090018"
     variation       2004
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886635358"
     variation       2015
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224567259"
     variation       2018
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896436073"
     variation       2023
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11539921"
     variation       2025
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467852976"
     variation       2037
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:997572826"
     variation       2038..2045
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ttgtt"
                     /replace="ttgttgtt"
                     /db_xref="dbSNP:1044501333"
     variation       2040
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938699740"
     variation       2044
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927337779"
     variation       2045
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563879503"
     variation       2054
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942169671"
     variation       2064
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:556822256"
     variation       2074
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401857871"
     variation       2081
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536928211"
     variation       2082
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:909367277"
     variation       2094..2098
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1333781824"
     variation       2099
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574398448"
     variation       2102
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039016931"
     variation       2103..2110
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aag"
                     /replace="aagtgaag"
                     /db_xref="dbSNP:1323169779"
     variation       2105
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202188913"
     variation       2118..2124
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gg"
                     /replace="gggaagg"
                     /db_xref="dbSNP:1201987755"
     variation       2133
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:903762965"
     variation       2141
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:755339845"
     variation       2141
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775610764"
     variation       2145
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042349201"
     variation       2150
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945184221"
     variation       2152
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776756750"
     variation       2160
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917777067"
     variation       2173
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553459320"
     variation       2182
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937736180"
     variation       2183
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1429009380"
     variation       2185
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567765537"
     variation       2200
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020790901"
     variation       2201..2205
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aataa"
                     /db_xref="dbSNP:1451858319"
     variation       2224
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009440766"
     variation       2232
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061431"
     variation       2238
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1178306820"
     variation       2240
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470186280"
     variation       2250
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745885945"
     variation       2255
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1428435266"
     variation       2262
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1303589744"
     variation       2264
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1197209690"
     variation       2280
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344604697"
     variation       2288
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1221951157"
     variation       2291
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280288418"
     variation       2292
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056404854"
     variation       2293
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1226691732"
     variation       2306
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429727570"
     variation       2308
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261859092"
     variation       2312
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:879204747"
     variation       2313
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1489786536"
     variation       2318
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1484679592"
     variation       2322
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1238908405"
     variation       2323
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1204629523"
     variation       2324..2329
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1196864482"
     variation       2327..2337
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaacaaa"
                     /replace="aaacaaacaaa"
                     /db_xref="dbSNP:1323552367"
     variation       2330
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:878935173"
     variation       2331..2333
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:11372331"
     variation       2332..2333
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1425243840"
     variation       2333..2335
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1491244321"
     variation       2333
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1003259201"
     variation       2334
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:11316512"
     variation       2334
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:60764900"
     variation       2335..2345
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs112880999"
     variation       2335
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aga"
                     /db_xref="dbSNP:398031013"
     variation       2335
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201901446"
     variation       2336..2337
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1555571495"
     variation       2336..2337
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aacaa"
                     /db_xref="dbSNP:1555571496"
     variation       2336
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1555571494"
     variation       2336
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:551446310"
     variation       2337..2338
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:575037869"
     variation       2337
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:201572572"
     variation       2337
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:796515393"
     variation       2338
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3209120"
     variation       2343
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1264330844"
     variation       2344..2347
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaca"
                     /db_xref="dbSNP:1285439792"
     variation       2344..2345
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:976379703"
     variation       2344
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:923496110"
     variation       2345..2351
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="acaca"
                     /replace="acacaca"
                     /replace="acacacaca"
                     /db_xref="dbSNP:967786066"
     variation       2345
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaca"
                     /db_xref="dbSNP:1555571483"
     variation       2345
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:568696453"
     variation       2346
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1381296634"
     variation       2346
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1242922953"
     variation       2346
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548782643"
     variation       2347
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1316656577"
     variation       2349..2359
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="acaaaa"
                     /replace="acaaaacaaaa"
                     /db_xref="dbSNP:1442760457"
     variation       2351..2354
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1483947116"
     variation       2355
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183744712"
     variation       2358
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020720602"
     variation       2367..2373
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaaagaa"
                     /db_xref="dbSNP:752361093"
     variation       2374
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294918681"
     variation       2376
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1408482286"
     variation       2378
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418240665"
     variation       2379..2380
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1157213963"
     variation       2381
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:973675289"
     variation       2384
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009370366"
     variation       2394
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336216845"
     variation       2406
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:960544858"
     variation       2417
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:978660984"
     variation       2419
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381612365"
     variation       2427
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962439117"
     variation       2430
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280596115"
     variation       2431
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:529125953"
     variation       2435
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222352977"
     variation       2446
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1002108724"
     variation       2456
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560399952"
     variation       2457
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866964250"
     variation       2460
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1262011874"
     variation       2465
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459561137"
     variation       2467
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951048440"
     variation       2470
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405116339"
     variation       2471
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233331053"
     variation       2473
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1174134341"
     variation       2493
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463435802"
     variation       2494
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030481712"
     variation       2498
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022959218"
     variation       2500
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997687342"
     variation       2501
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1169125351"
     variation       2506
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183140947"
     variation       2507..2510
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:35992798"
     variation       2510
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1047814736"
     variation       2512
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929452184"
     variation       2522
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467194776"
     variation       2523..2535
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tgttaattttttt"
                     /db_xref="dbSNP:1040970423"
     variation       2529..2541
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /replace="ttttttttttttt"
                     /replace="tttttttttttttt"
                     /db_xref="dbSNP:59034311"
     variation       2529
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330147545"
     variation       2530
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:902001912"
     variation       2542
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1346510700"
     variation       2544
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461116499"
     variation       2547
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223784509"
     variation       2551
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282193301"
     variation       2559
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774306822"
     variation       2561
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768452774"
     polyA_site      2568
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     variation       2575
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001273033"
     variation       2576
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481239034"
     variation       2583
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903878933"
     variation       2592
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1270817693"
     variation       2618
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946374543"
     variation       2620
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:913627726"
     variation       2628
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225249717"
     variation       2633
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:556635462"
     variation       2654
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042683582"
     variation       2673..2674
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1476508938"
     variation       2697
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945283137"
     variation       2698
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:960470057"
     variation       2700
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1245567520"
     variation       2702
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1034847989"
     variation       2710
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:896422662"
     variation       2717
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:527677909"
     variation       2719
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:535935117"
     variation       2721
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1380911108"
     variation       2728
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432431503"
     variation       2729
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270309265"
     variation       2737
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:981047533"
     variation       2743
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1212755937"
     variation       2744
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293777849"
     variation       2745
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359890603"
     variation       2749
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221550664"
     variation       2753
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:969330114"
     variation       2758
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1334428012"
     variation       2764
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1241629516"
     variation       2765..2775
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tg"
                     /replace="tgtcctccctg"
                     /db_xref="dbSNP:1397035963"
     variation       2766
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937853846"
     variation       2769
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145386680"
     variation       2771
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1386333270"
     variation       2777
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1424580546"
     variation       2787
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297548419"
     variation       2788
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1459980916"
     variation       2789
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162128235"
     variation       2790
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386591655"
     variation       2797
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163709382"
     variation       2813
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006148452"
     variation       2815
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:887796694"
     variation       2816
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1325359629"
     variation       2817
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427954982"
     variation       2818
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026296647"
     variation       2821
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1383506634"
     variation       2828
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1443605907"
     variation       2835
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:531874228"
     variation       2839
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993529456"
     variation       2858..2863
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1445358431"
     variation       2863
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:973888146"
     variation       2864
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:941012352"
     variation       2868
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383062186"
     variation       2891
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184423572"
     variation       2893
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1444604568"
     variation       2910
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1420054557"
     variation       2919
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:116782699"
     variation       2928
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74441281"
     variation       2933
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044384839"
     variation       2934
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:946343523"
     variation       2942
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1455301779"
     regulatory      2944..2949
                     /regulatory_class="polyA_signal_sequence"
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
     variation       2945
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:950958016"
     variation       2947
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1338187205"
     variation       2952
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406140312"
     variation       2954
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451871368"
     variation       2963
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:913554405"
     polyA_site      2966
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
ORIGIN      
ggggaggaggccgcgcggggtggggtctggcggtacgcgctggctgcgtcgacgtgctgacgccatgacgccccggctggtgtgtgtcggtgtgtatgtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgtatttgtgtatcggcggtcccgcaggtcccggatgttgcggacagtatgaggcaagcgcagggggacggggaccagcagctgtcgccgccgctctcaggctctgggaaccacccttctactttctgtctctaggaatttcactactctagggtgaagagggaacagaaatctttgccccctgactttggaaatctcgtttaaccttcaaactggcgatgtcaagggttccaagtcctccacctccggcagaaatgtcgagtggccccgtagctgagagttggtgctacacacagatcaaggtagtgaaattctcctacatgtggaccatcaataactttagcttttgccgggaggaaatgggtgaagtcattaaaagttctacattttcatcaggagcaaatgataaactgaaatggtgtttgcgagtaaaccccaaagggttagatgaagaaagcaaagattacctgtcactttacctgttactggtcagctgtccaaagagtgaagttcgggcaaaattcaaattctccatcctgaatgccaagggagaagaaaccaaagctatggagagtcaacgggcatataggtttgtgcaaggcaaagactggggattcaagaaattcatccgtagagattttcttttggatgaggccaacgggcttctccctgatgacaagcttaccctcttctgcgaggtgagtgttgtgcaagattctgtcaacatttctggccagaataccatgaacatggtaaaggttcctgagtgccggctggcagatgagttaggaggactgtgggagaattcccggttcacagactgctgcttgtgtgttgccggccaggaattccaggctcacaaggctatcttagcagctcgttctccggtttttagtgccatgtttgaacatgaaatggaggagagcaaaaagaatcgagttgaaatcaatgatgtggagcctgaagtttttaaggaaatgatgtgcttcatttacacggggaaggctccaaacctcgacaaaatggctgatgatttgctggcagctgctgacaagtatgccctggagcgcttaaaggtcatgtgtgaggatgccctctgcagtaacctgtccgtggagaacgctgcagaaattctcatcctggccgacctccacagtgcagatcagttgaaaactcaggcagtggatttcatcaactatcatgcttcggatgtcttggagacctctgggtggaagtcaatggtggtgtcacatccccacttggtggctgaggcataccgctctctggcttcagcacagtgcccttttctgggacccccacgcaaacgcctgaagcaatcctaagatcctgcttgttgtaagactccgtttaatttccagaagcagcagccactgttgctgccactgaccaccaggtagacagcgcaatctgtggagcttttactctgttgtgaggggaagagactgcattgtggccccagacttttaaaacagcactaaataacttgggggaaacggggggagggaaaatgaaatgaaaaccctgttgctgcgtcactgtgttccctttggcctggctgagtttgatactgtggggattcagtttaggcgctggcccgaggatatcccagcggtggtacttcggagacacctgtctgcatctgactgagcagaacaaatcgtcaggtgcctggagcaaaaaggaaaaaaaaaaaagaaaggacattgagttttaacagaagggaaaaggaaagaagaaaagatttttgcagaatttctcaaaaatcagtttgtggattccagtagtatttatattgagagaaacaaattttagtccttctaactgtgctaaaacttggatatttgtgaaaactccttaccaccatacaagcatcagaagagctctcttgttgttagcacttattgtttgcaagaacagaatacatccttttatccttttatgaaaaatgacaagtgaaggcaaaaggggaaggttatttgatctggaagatgagtgttctgatgtggtggcttttgcaaaaatctttattggtgttgaaaactggaaaaaataactcatccagaattcatattgtcttgacaagaactatggttctctgtttttagatattgtggaaaatgtttttgggcatttttctctgattttatttcttctcccccacccctttttctaaaaaacaaacaaaaaaaaaaacacacaaaacaaaaacagaacaaaagaagagagaaggaaattttatcaattaaaaatgctgtgtgataaaatcccagcccagattgctcagctgtttgtacctgacttgccgcctgcataggagccagttctgttccttctgactagcccctcttcctccaggggagaacttccaaatgttaatttttttttttttgaaaatataaataattactattttgtactgtgtggtatctctggtcttttgtttcactcacctgccttgtctcttgggtctgagtcccttgcttaagggattttgaagtcctagttttcagcttgcagagattatgtctgaaatgcctaatgagtcgcagggatttgttgagactccgtaatctcaagttctctttgtgagctatcagcatctgccagtctcttgtcctccctgagtatctcacagtccatatcctgatgagggatcaggcccctacctctgccaaggcaagtaatggtagtgggcttttaaactgccccccgtatgttttaagacctaatccccacctcccttcttctaactaaatataaaaagatccaggggacataaatgtggagattaaataaagggaaattattgtctctaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]