GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-01-22 11:42:24, GGRNA : RefSeq release 85 (Nov, 2017)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Biomphalaria glabrata clumping factor A-like (LOC106075409), partial mRNA. (812 bp)
db_xref="GeneID:106075409" CDS <1..812 /gene="LOC106075409" /codon_start=3 /product="clumping factor A-like" /protein_id="XP_013091805.1" /db_xref="GeneID:106075409" /translation="QGHSENKDHSKNKDHSKNKDHSKNKDHSKNKGHSKNKDHSKNKDHSKNKDHSKNKDHSKNKDHNKNKDHSKNKGHSKNKDHSKNKDHRKNKDHRKNKDHSIEADIKTDIETDIKTDNETDIETDIKTDIETDIKTDIETDIETGIKADIKTDIETGIETGIKTDIETDIETDNETDIETDIETDIETDIETDIETDNETDIETGIETDIETDIETDIEIDIKTDIKTDIETDIKTDIKTDIETDIETDIKTDIETDIETDIETDIEIDI" misc_feature <141..800 /gene="LOC106075409" /note="Ring-infected erythrocyte surface antigen; Provisional; Region: PTZ00341" /db_xref="CDD:173534"...
AA_position 109
XM_013236351.1 - Biomphalaria glabrata - NCBI
Malassezia globosa CBS 7966 hypothetical protein MGL_3332 partial mRNA. (2646 bp)
RSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSRTSPRKPHETAAMPHSHRTSSCKTETSVVTSMTTSVDSRGETHTRATTMTTMVPESSCRSMTTPKQTKSCSSMTSVIETDVISTDSKGRKHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISTDSKGRKHTSSTVKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPTSTTRSTVKPSKKSTTSCSSMTSAIETDIIS...
AA_position 362
XM_001729736.1 - Malassezia globosa CBS 7966 - NCBI
PREDICTED: Strongylocentrotus purpuratus mucin-22-like (LOC105437553), mRNA. (3444 bp)
codon_start=1 /product="mucin-22-like" /protein_id="XP_011662571.1" /db_xref="GeneID:105437553" /translation="MGFLMLGSEIREGNTSIVVVVDSAEVVTADKKSQFVEIKGTLVADRQRYISRERREGLSAIDEVEQKVRAATAQETTEDVTTVIVTEMVTELDNEVDTVTDDVTDIITILDKDDENVTATDVSVFGTELITEVVTELGTDKLATEIVTEDSTEIVTIVSEEFTDETEIITDLTRATEEFTEVTEIETDQTEIVTDVTNFVTDVTEEFTDETEIITDLTRATEEFTEVTEIETDQTNIVTDVTNFVTDVTEEFTDETEIITDLTRATEEFTEVTEIETDQTNIVTDVTDFVTDVTEEFTEETEIITDLTRVTEEFTEVTVFETNQTNIVTDVTNFVTDVTEEFTDKTEIITDLTRATEEFTEVTEIETNQTEIITDVTNFVTDVTEEFTEETEIITDLTRATEEFTEVTEIETDQTEIVTDVTNFVTDVTEEFTDETEIITDLTRATEQFTEVTEIETDQTEIVTDVTNFVTDVTEEFTDETEIITDLTRA...
AA_position 185
XM_011664269.1 - Strongylocentrotus purpuratus (purple sea urchin) - NCBI
Galdieria sulphuraria hypothetical protein (Gasu_26660) mRNA, complete cds. (2170 bp)
hypothetical protein" /protein_id="XP_005706398.1" /db_xref="GeneID:17088646" /translation="MKLLQSFCLLSLCIIFCLSPLLAEAADYERLCHCFQQDTSAFDLYKLVGTYSVTSCSSCNEKNCAALFGEQESDYNKLCAYIGESVVDAVESVLEGDFKSAETYMQDLISNQTTLIENYIDKLLGYLNNTLDGFRNEVGTNITVIEQEINEINTTFIAQDIQEAVTQIENYVSKDINEAITSLEVQIQKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNVTSDIDQAINTLKEFVDSVSVDVEANISLDINKAVKTLQ...
AA_position 205
XM_005706341.1 - Galdieria sulphuraria - NCBI
PREDICTED: Prunus persica dr1-associated corepressor (LOC18789907), mRNA. (1488 bp)
db_xref="GeneID:18789907" /translation="MAEEQNAAREEENAEQREENAEQAEENAEQEEENAEQADENAEQEEDDAEQEEDNSEKAVENAAVKEKAKVAQEEENAEPIRSENSQIRPEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEVATEKKRKIVKLEHMRVAVKRHRPTSDFLLDELPVPSQPSDHQPTDRSSSRTVSHAPAPARRDRSRSRAVSYKPAPAGTRRIDHFFRTKEIPIQTEQSLIETEEAPIETEEASIEIDEAPIETDEGPIETDEASIETDEASIETDEASIETDEAPIVTDEGPIETGEGPIETNES" misc_feature 546..737 /gene="LOC18789907" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 256
XM_007227173.2 - Prunus persica (peach) - NCBI
PREDICTED: Stylophora pistillata uncharacterized LOC111332102 (LOC111332102), transcript variant X2, mRNA. (4985 bp)
introns" /db_xref="GeneID:111332102" CDS 98..4513 /gene="LOC111332102" /codon_start=1 /product="uncharacterized protein LOC111332102 isoform X2" /protein_id="XP_022793107.1" /db_xref="GeneID:111332102" /translation="MMFDPFNPSPEPAIESDEDTMSPRERNASTDVNSMTLSSEHSFTPPSSTDQNDLSSMTGEEYREDNGNSAECNSSIETDMTVLREPYREENAEGPFNPSPGPAIESDEDTVPPREKDASSVVISITTSSEHPSTTPSSSDRNELPSMNGEENQEDNGSSAECNSSIETDMTVLRESYRDDNAEGPSSPSPAPTFESDEDTVPQREKDASSDVDSMTPSSEHSSTPPSSTDENCLPFMPGEENQEAKGSSADSKSSIETDITVLEEPYRGDNREGPFILIPGPVIENDKDTEPPLNKDASTDVNNMTTSSEHSSSPPTSTGQNNLPFITMEEYREDNGNSAETKSSIETDMTMLEVPNRSENREGLFTLSPAPAIESDENTAPPR...
AA_position 76
XM_022937372.1 - Stylophora pistillata - NCBI
PREDICTED: Stylophora pistillata uncharacterized LOC111332102 (LOC111332102), transcript variant X1, mRNA. (5165 bp)
introns" /db_xref="GeneID:111332102" CDS 98..4693 /gene="LOC111332102" /codon_start=1 /product="uncharacterized protein LOC111332102 isoform X1" /protein_id="XP_022793106.1" /db_xref="GeneID:111332102" /translation="MMFDPFNPSPEPAIESDEDTMSPRERNASTDVNSMTLSSEHSFTPPSSTDQNDLSSMTGEEYREDNGNSAECNSSIETDMTVLREPYREENAEGPFNPSPGPAIESDEDTVPPREKDASSVVISITTSSEHPSTTPSSSDRNELPSMNGEENQEDNGSSAECNSSIETDMTVLRESYRDDNAEGPSSPSPAPTFESDEDTVPQREKDASSDVDSMTPSSEHSSTPPSSTDENCLPFMPGEENQEAKGSSADSKSSIETDITVLEEPYRGDNREGPFILIPGPVIENDKDTEPPLNKDASTDVNNMTTSSEHSSSPPTSTGQNNLPFITMEEYREDNGNSAETKSSIETDMTMLEVPNRSENREGLFTLSPAPAIESDENTAPPR...
AA_position 76
XM_022937371.1 - Stylophora pistillata - NCBI
PREDICTED: Drosophila serrata DM7 family protein GG19680-like (LOC110184807), mRNA. (3021 bp)
FELPADIFPVDINRPGPRFLPQRFLPDFCDAGCVFPPGSLPDSVFHGAIRTHYDLEQHHYSMTPPLFVGQCKQQQEQPCDNGTVQVYKIDPVAMQLKKLALRNMAATKKDTTKIPVPLPEGTKRSHDFKLAAQAGKPKGFVLIESDHVPRGAIPTDFFGAFLMGCFFMIAPNNKGVTQSSSESEDDEEDEQEFLDFQNNMFTMVKLNRGSLAGVPAVEKTEVQKAEVKEPETEESEAELNSEEYETEEYLDEDCESEGYEAEEIDTDEYEAEVRRIEEIDPDEIDTDEYEAEEVDPDEIETDEYEADEDKTEELDPDEIETDEYEAEEGKTQELNQDEIETDEYEADEGKIGELNPIEIETYEYKADEGKTKELNQGDIETDEYEPVEAKTKEVNQDEIETDEYEPVEANTKELNQDDIETDEYDPEQADGKKPKVVQKSDIAEPPAKEPSLKRKHTNTDNEYTNRIAPDYTGCDKVYSYFTIDSNLDDIAEAAGDLTTARFEVIVHASELPGIDVNRAVEQFRQVLQCRNEIRAKMTGLINAHDAKMEADHKVVLVSPVPEVNTKRVFRKTCSQCGKNH" misc_feature...
AA_position 623
XM_020953443.1 - Drosophila serrata - NCBI
PREDICTED: Plutella xylostella probable GPI-anchored adhesin-like protein PGA55 (LOC105397220), mRNA. (1771 bp)
db_xref="GeneID:105397220" /translation="MDPAIIFPSHLFDQSFGMCITPQDLILPTNNIINPNYHRPWKWYIENISKDSGSTIESDKNKFQVTLDVQHFKPDEISVTVINKEIIIEGKHGERLDDHGVVSRQFLRRYALPVDCDSDDVTANLSSDGILMVCAKKKMIQNLTNERQVHIQLCDSLLTKEVKSNLSSKTSDEEMNKSQIKKQDEKCDINIKCEKSKQEAEEKSNMKSSSLDDSRHSKNSQLMLREDHSRLLKPEFLGETLSNVGGTIIKESKIETDELLEMSSSRAGKANVEGTTKETKKIETDEHLEMSSSRIGGTITGAKIETDELLEMSSSRFGMGNVGGTIKAKIETDELLEMSSSRIGGTITGAKTETDELLEMSSSRFGKGNVGGNIKEAKIETDELLEMSSSRIGGTITGAKTETDELLEMTSSRFSKGNIGEIIKEAKIEADELLEMSSSRVAKAMDSISAISDEMLNMAIGNAYQSSMMATEESSTISSEKMSSGSMALSEESMKVVSETGQSSMETTSEKASFSSSSMSSEVVSSQESSSLMSSMSSSVKASSEIATSELLSDRISAA...
AA_position 254
XM_011569231.1 - Plutella xylostella (diamondback moth) - NCBI
PREDICTED: Camponotus floridanus uncharacterized LOC105255116 (LOC105255116), mRNA. (2217 bp)
alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:105255116" CDS 307..2115 /gene="LOC105255116" /codon_start=1 /product="uncharacterized protein LOC105255116" /protein_id="XP_011262511.2" /db_xref="GeneID:105255116" /translation="MNMTKHPLYETSTDSTENIITSTSIETDSTEDITTSTSIETDSTEDITPSTSIETDSTENKTTSTSIETDSTEDTNDTKPSAPTNSPDDDDTASFTFINFHPHISDVTSADNQAETLKVEFEELRRNDDNLHKFTEMAIFRNHYMFPTVPNTVLSKQKNTLKSVLNQKSSKTNEDIAISTKQKLEKKDHISKNKHCKKPQSLVLWRPLAPPIQDLEEKSRIYKLLMKHVFTRESRLIFNYKRERRSSLPFTPIPKLLAICPPPPESTTSELLNVIEKPNTSKSDINLDSQSSKTCIFTKQAKIKTPKDSTNESNSSTDDESYIDTEQSTHS...
AA_position 25
XM_011264209.2 - Camponotus floridanus (Florida carpenter ant) - NCBI
PREDICTED: Astyanax mexicanus titin-like (LOC103031050), mRNA. (5686 bp)
AVPAETIILTNTETPKLAQTGNFFKMFKKKNEPVIPEPEVTLDVSVQQNSELPALILTDNALPTPEPVPAAVVSVEVSPDPAVPAETIILTNTETPKPVQTANFFKMFKKKNDPVIPEPEVSLDVSVQQNSEPPAMILTDNALPTPEPVPAAVVSVEVSPDPAVPAETITLTNTEPIKPVQKPSLFNRFKKKNEPAIPEPEVSLDVSVQQNSEPPSIILTDKALPTPEPVPAAVVSVEVSPVPAVPAETITITNTGTPKPAQKPSLFNRFKKKNESVIPEPEVSLEVSVQQNSDLPTMIETDNALPAPEPVPAAVVSVEVSPDPAVPAETITLTNIEPPKLAQKPSLFNRFKKKNEPVIPEPEVTLDVSVQQNSDLPTMIETDNALPTPEPVQLQSYLWKFKKKNEPVIPEPEVSLDVSVQQNSEAPSIILTDKALPTPEPVPAAVVSVEVSPVPAVPAETITLTNTEPPKLAQKPSLFNRFKKKNEPVIPEPEVSLGVSVQQNSEAPSIILTDKALPTPEPVPAAVVSVEVSPVPAVPAETITLTNTEPVPAAVVSVEVSPVPAVPAETITLTNTETPKPAQKPSLFNRFKKKNEPVIP...
AA_position 380
XM_022676745.1 - Astyanax mexicanus (Mexican tetra) - NCBI
[Candida] auris hypothetical protein (QG37_04037), partial mRNA. (4047 bp)
GeneID:28877770" /translation="MTTSTSLLPVPFTTYTSTWTITNSDGSQATDSGIVIVTTDSEGQLTTTTSVIPPPFTTYTSTWTTTGANGGEETDSGVIIVTTDSDGQLATTTSVIPPPFTTFTSTWTTTNSDGNQATDSGVVIVTTDSDGQLTTTTSVIPPPFTTYTSTWTTTGADGSEETDSGVIIVTTDSAGQLTTTTSVIPPPFTTFTSTWTTTDGNGNEGTDSGVIIVTTDSDGALTTTTAVIPPAAGSGTDALSSSIDDVPYTTYTSTWTTTDGNGNIETDSGVVIVTTDSEGSLTTTTSIIDSPFTTYTSTWATTDNNGNVETDSGVVIVTTDSNGQLTTTTSVIDSPYTTYTTSWPTTDANGGVETDSGVVIVTTDSNGQLSTTTSVIDSPFTTYTTSWPTTDGNGAVETDSGVVIVTTDSNGQLTTTTSVIDSPYTTYTTSWPTTGADGAVETDSGVVIVTTDSDGQLTTTTSVIDSPYTTYTSIWTTTDSVGNVETDSGVVIVTTDSDGQVTTTTSRFENSPSDLTEYTTTWASTDSDGNIKTDSGVVVVTTDSAGSTTTSTSTFDTPYTTFTSTWTTT...
AA_position 264
XM_018313382.1 - [Candida] auris (Candida auris) - NCBI
PREDICTED: Prunus avium retrotransposon-like protein 1 (LOC110769621), mRNA. (1268 bp)
translation="MAEEQNAAREEDNIAPEENAEQGEENAEQEEENAEQEEENAEQEEENAEQGEEKAEQEEEDAEKAEENAEQEEDDAEQEEDNAEQEEDNPEKAVEKAAVKEKAKVAQEEENAEPIRSENSQIRAEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEIAMEKKRKIVKLEHMRVAVKRHRPTSDFLLDELPVPSQPSDHQPTDRSGSRTVSHAPAPAREDRRRSSAVSDKPAPAGTRRIDHFFRAKEIPIQTEKSLIETDEASIEIDEAPIETDEGPIETDEAASIEMDEAPIVTDEGPIETGEGSIETNKS" misc_feature 373..564 /gene="LOC110769621" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 269
XM_021973644.1 - Prunus avium (sweet cherry) - NCBI
Plasmodium reichenowi rhoptry-associated membrane antigen, putative partial mRNA. (2682 bp)
codon_start=1 /product="rhoptry-associated membrane antigen, putative" /protein_id="XP_019970605.1" /db_xref="GeneID:24530305" /translation="MNVLLLSLLVVQNIVTYLEQIKNGISGHYVEDHNIKNDNCISFSDYERSIKNFSISSHAENNYDNIINEYKKIKDINNNINILSSVHRKGRILYDNFLEINNLENEKKENDEKEDEYEYEDNDESFLETEEYEDNEDEKYNNDEDDYAESFIETDKYEDNEDDKYNKDEKYNKDEKYNKDEDDYAESFIETDEYEDNKDDKYNKDEDNYSESFIETDEYDDNEEEQYNKDEDGYADSFIETDHYGNNDDKNEEEEEEYNDQDNDYGYNFLETDEYDDSEEYDYDDNEYGESFLEKEEGEEMKDEEMKYDEMKDDQMNYDEMKDEEIKDDEMKYDEMKDEEMKYDEMKDEEMKYDEMKDDEMKNDEMKYDEMKDEQMKDEQMKDEQMKYDEMKDEQMEYEEFKNEDKKKEDMSYDEYMGYKKKEQEESYNTYNGNKKNKTSDSFLEKDLQGNSDDELHST...
AA_position 152
XM_020114648.1 - Plasmodium reichenowi - NCBI
Nematostella vectensis predicted protein (NEMVEDRAFT_v1g63537) partial mRNA. (348 bp)
dev_stage="larval" gene 348 /locus_tag="NEMVEDRAFT_v1g63537" /db_xref="GeneID:5520424" CDS 348 /locus_tag="NEMVEDRAFT_v1g63537" /codon_start=1 /product="hypothetical protein" /protein_id="XP_001640177.1" /db_xref="GeneID:5520424" /translation="LHIDKEELYIDSDELHIDTSKSHIDTDELYIDTDELHIDTDEIHLDTDKFHIETDDLHIDIDELHIETYELHIDTDERVVLDTDELHIDTDEIHLDTDKLHIETDELHIDTDELHI" ORIGIN // REFERENCE 1 (bases 1 to 348) AUTHORS Putnam,N.H., Srivastava,M., Hellsten,U., Dirks,B., Chapman,J., Salamov,A., Terry,A., Shapiro,H., Lindquist,E., Kapitonov,V.V., Jurka,J., Genikhovich,G., Grigoriev,I.V., Lucas,S.M., Steele,R.E...
AA_position 52
XM_001640127.1 - Nematostella vectensis (starlet sea anemone) - NCBI
Verruconis gallopava hypothetical protein mRNA. (1369 bp)
locus_tag="PV09_09831" /codon_start=1 /product="hypothetical protein" /protein_id="XP_016208194.1" /db_xref="GeneID:27317804" /translation="MKGLIGCLEADDMDKMMTALSEARADEVLQNDTESTVQTLVLSQEAEGPTLRMQVLDALQSLAQIHIMHEMMVLKLQTEVGVGNSRTLTLETFKTNQNNMNERISFLIGSLEADDMDKMRTALEEADAVRTAVNENITKTATLLQESLIETDNDKAKEVPKIETDSGIEVEPASQIKEE" ORIGIN // REFERENCE 1 (bases 1 to 1369) AUTHORS Cuomo,C., de Hoog,S., Gorbushina,A., Stielow,B., Teixiera,M., Abouelleil,A., Chapman,S.B., Priest,M., Young,S.K., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE The Genome Sequence of...
AA_position 149
XM_016363977.1 - Verruconis gallopava - NCBI
PREDICTED: Sinocyclocheilus grahami dachshund homolog 1-like (LOC107600400), mRNA. (646 bp)
gene="LOC107600400" /codon_start=1 /product="dachshund homolog 1-like" /protein_id="XP_016147783.1" /db_xref="GeneID:107600400" /translation="MCTPTARDSYERLSFAGQTLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMELFRERELRETLEKQLAVEQKNRAIIQKRLKKEKKAKRKLQEALEYESKRREQAEQSLKQTSTTESLRSLNDSLTQEIETDRSSGRTDAERTIQDSLTQEIETDRSSGRTDAERTIQACCSCIQPAIWAADPTVQEEGQDQ" ORIGIN //...
AA_position 149
XM_016292297.1 - Sinocyclocheilus grahami - NCBI
PREDICTED: Rhagoletis zephyria dehydrogenase/reductase SDR family member 4-like (LOC108356739), partial mRNA. (696 bp)
CDS <1..696 /gene="LOC108356739" /codon_start=1 /product="dehydrogenase/reductase SDR family member 4-like" /protein_id="XP_017463329.1" /db_xref="GeneID:108356739" /translation="TLKHFGGIDIFVSNAAVNPAKSHILETSDEVFEKILAVNLIAPFSLSKDIVPHMVKRGGGNIIYIGSASGYMYQGAQNLSERMAAYAISKTALLGLTKAVAGKCAPLNIRVNCVAPGLIETDFAVSITGSPDYPGSFLPLQXATSSTSAAPPGAPLNIRVNCVAPGLIETDFAVSITGSPDYPGSFLPLQTIKRIGRAEEVAGMVAFLCSKDASYISGETCTVAGGNGTRL" ORIGIN //...
AA_position 119
XM_017607840.1 - Rhagoletis zephyria (snowberry fruit fly) - NCBI
PREDICTED: Harpegnathos saltator uncharacterized LOC105188109 (LOC105188109), mRNA. (6358 bp)
ISEEQPLFDLKYPIVKEANASAAFENINNITGMDEKATETVTHATDKMPPRRTRIYSDKRINLMFKHNQNALNDASEASTNSTLRDNITEKAINFCERSNRKVKSTTTTEEGLTDKCSTETDIDEKATKSVTHTTDKMPSRRTRFYSDKRISQMCKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSMITTEEDFTNKCSTEIDIDEKATKSVTHTTDKMPPRRTRFYSDKRISQMCKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSTTTTEEDFTDKRSIETDINERAAKSVTHSTDKMPPRKTRIYADKRISQMFKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSTTTTEEDFTDKRSIETDINERAAKSVTHSTDKMPPRKTRIYADKRISQMFKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSTTTTEEDFTDKRSIETDINERAAKSVTHSTDKMPPRKTRIYADKRISQMFKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSMITTEEDFTNKCSTEIDIDEKATKSVTHTTDKMPPRRTRFYSDKR...
AA_position 421
XM_011149400.2 - Harpegnathos saltator (Jerdon's jumping ant) - NCBI
Plasmodium falciparum 3D7 rifin-like protein (RAMA), partial mRNA. (2586 bp)
rifin-like protein" /protein_id="XP_002808767.1" /db_xref="GeneID:9221885" /db_xref="GOA:C0H4M0" /db_xref="UniProtKB/TrEMBL:C0H4M0" /translation="MNVLLLSLLVVQNIVTYLEQIKNGISGHYTEDHNIKNNNCISFSDYERSIKNFSISSHAENNYDNIINEYKKIKDINNNINILSSVHRKGRILYDSFLEINKLENDKKEKHEKEDEYEDNDESFLETEEYEDNEDEKYNKDEDDYAESFIETDEYEDNEDDKYNKDEDDYSESFIETDEYDDNEEEQYNKDEDDYTDSFIETDHYENNDDKNEEEEEYNDQDNDYGYNFLETDEYDDSEEYDYDDKEYGESFLEKEEGEEMKDEEMKDEEMKDVEMKDEEMKDEEMKYDEMKNEEMKYDEMKDEVMKDEEMKDEVMKDEEMKDEQMKYEEFKNEESKNEESKNEESKNEESKNEEFKNEESKNEEFKNEEFKNEDMSYDEYMGYKKKEEDESYNTFNGTKKNNTSNSFLEKDLQGDSDDELHSTFYSKNVDKENYDDKNIFYGYSDNDDESFLE...
AA_position 150
XM_002808721.1 - Plasmodium falciparum 3D7 - NCBI
PREDICTED: Prunus mume dr1-associated corepressor (LOC103322124), mRNA. (1320 bp)
GeneID:103322124" /translation="MAEEQNAAREADNIAGEENAEQEEENAEQEEEKAEQAEENAEQAEEKAEQAEDDAEQEEDNAEQEEDNPENAVENATVKEKAKVAQEEENAEPIRSENSQIRPEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEVATEKKRKIVKLEHMRVAVKRHRPTSDFLWDELPVPCQPSDHQPTDRSSSRTVSHAPAPARRDRSRSRAVSDKPAPAGTRRIDHFFLTKEIPIQTEQSLIETEEAPIETEEAPIETDESPIETDEASIETEEASIEIDEAPIVTDEGPIETGEGPIETNES" misc_feature 475..666 /gene="LOC103322124" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 262
XM_008224006.2 - Prunus mume (Japanese apricot) - NCBI
PREDICTED: Xenopus laevis uncharacterized LOC108695696 (LOC108695696), mRNA. (6063 bp)
KQKETDTKQNEAVTEHGNTTVKYEQYESENEQWQTATEQWETDREEGTTDTHDIHPLIAQKMDRERDTEETANQSRRETLSEDSEEWETASDDSIDRPVLVQNEETVDWVIREVREIMREREVEDSEDLNTISHGIQTASLTSHEVTDTIREGETVVDKRTSVNESETGETGGTLAMNNEDNVLETIRDGTTETGTEGSVTQPEERQQETEGTAVKIGEQWDLLEERKDTSAEIMAPSKTTERQESEMEKLEQEEIPEESQEDGIVIERGLCNLLGTDTRVQGQGLLETDTGVQGQGLIETDTGVQGQGLIETDTGVQGQGLTETDTGVQGQGLLETDTGIQGQGLLETDTGVQGQGLIETDTGVQGQGLIETDTGVQGQGLIETDTVVQVQGLLETDTGVQGQGLMETDTGVQGQGLTETDTGIQGQGLLETDTGVQGQGLLETDKGVQGQGLIWTDAEVQGQGLLETDTGVQGQGLLEIDTGVKGQGLLETDTGVQGQGLLEIDTGVKGQGLLKTDTGVQVQGLMETDTGVQGQGLLGTDTGVQGQGLLETDTEVQGQGLLETDTGVQGQGLMEQEITCQFGDVTKQSLDHKSAEKVH...
AA_position 599
XM_018224672.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Latimeria chalumnae uncharacterized LOC106707086 (LOC106707086), mRNA. (939 bp)
includes similarity to: 56% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:106707086" CDS 1..939 /gene="LOC106707086" /codon_start=1 /product="uncharacterized protein LOC106707086" /protein_id="XP_014354384.1" /db_xref="GeneID:106707086" /translation="MSGNSGHPKIETDGGAGGELSVRDEDTEQRLPKPNTVTQDCKATLYTEVMKKNVRNNMNHCPPVTPVYENVDQFQSTKNVEGLMSPENTHAGKKVSSLSDILLLGISQSQIPRLPTEQAIFQPWGCGPGQGNCSDQKVLLCNLIPAGLKPQDLRSSEEEEEEEPDYCNLDPNESGNGIPPPVPQKTHDEKQGRRPWPSPTPPEGSVRKTPCLYEEEREEEPDYCNMIETDGLLQSHDPTGHLPTITAFEKFNSTQTVYSTPHSLRTLESEMPGGDGGRHPGQLPHAFCPAKKFRNGVCMKPIPQPQEDEWTD"...
AA_position 10
XM_014498898.1 - Latimeria chalumnae (coelacanth) - NCBI
PREDICTED: Acyrthosiphon pisum GATA zinc finger domain-containing protein 14-like (LOC107885061), mRNA. (1951 bp)
GeneID:107885061" /translation="MSKTEISSCDDEVSSKSISKMRSPPKLLTKDIQKKHNKLHSLFNENFNHEQIDENSYDSDKDPEYIQPSILNTLNKNALSTCISTITKCNNSAKNSPTERMIADKNQDFLQPLVISQSKDKNNTPKCFSVKRALFETHETFNHVSADSSNKKHYSIQNSPAGKIGAKDIDQDFGQPLSQSYYNKNNYSKFSLEKASFETNEFNQENAESSNSRHSILNSPIGKIVVEDNDQNFSSSHSNSLSNNKNYKLMFSSAKRTIFDTIETDEIFNQENAESSNSRHSILNSPIGKIVVEDNDRNFSYSHSNNKNNKLKFSSAKRTIFDTIETDEIFNQENSESSNTRHSILYSPIGKIVVGDNDQNFCYSHSKSVSNVKNSNTPMFYSAKTNNTADKLMPNCDFQTFVINALSKMKYDISGINSKTNATHILLNSFVTNSGNSSIQEQLNNNQIGQTSEYYNLFPIQTEEDLQTAESRILDKNIRSNLVLQLSLLVGIKDVGDSVRRLMIKMFSDEVLTLYSLLGFKKKKNFSKLGCYTLLIDALRVHSKFKDVINKDFDKPLATWIAHASFRL...
AA_position 262
XM_016808420.1 - Acyrthosiphon pisum (pea aphid) - NCBI
PREDICTED: Dendroctonus ponderosae uncharacterized LOC109536759 (LOC109536759), mRNA. (613 bp)
db_xref="GeneID:109536759" CDS 44..553 /gene="LOC109536759" /codon_start=1 /product="uncharacterized protein LOC109536759" /protein_id="XP_019758675.1" /db_xref="GeneID:109536759" /translation="MKFVAVFVVAFVAYASASIISGDRRPIFTNEVESEQVEGSNLPAEIESDNIEISNLPAEIESDNIEISNLPAEIESDNIEISNLPAEIESDNIEISNLPAEIETDEIEISNLPAEIETDKIEISNLPAEIETEDKPQLDGLRPDVETLSVCDLCFSQIATLVEELQRAL" misc_feature <128..550 /gene="LOC109536759" /note="RecF/RecN/SMC N terminal domain; Region: SMC_N; cl25732" /db_xref="CDD:330553" ORIGIN //...
AA_position 102
XM_019903116.1 - Dendroctonus ponderosae (mountain pine beetle) - NCBI
Trichosporon asahii var. asahii CBS 2479 hypothetical protein partial mRNA. (1512 bp)
start=1 /product="hypothetical protein" /protein_id="XP_014183074.1" /db_xref="GeneID:25990875" /translation="MKTIDHLSYPHIIDLIFDYATEEALFAMGRACREWRTRVVAEFYHLRDLTVRRGALISDNVTDESSDISAHSQHFVFESPAGCYTAVSNLACMDYCRVVDFGDGPVPLADGVVFNVTPFAYRCLPTQHMSLYNFVTQLPRWQNNLEHNGPKFTFVARSPPSILQTPNVAFLTLDEYRDTIGEKEFAIETDFDSSELNGAHRAGGGCAPSLAVTWMTIKHLNFAHLTIALPGIAMLIIDHLSYPHVVDLLFAFAPVQSLVVMGDTCREWRKRVAAELYHLRGFSTGCSKNQPTWWIGEKEPDSIQWHFYFETQRGYAAITDPRCLRFCRVVDLATLYDFEDVENKKHTLRVDTVRLPQLHPIEKTDMGSIAPFVCSRVVLDNHFGLRTEREISKLVVNHRNDDYRHHTPHWSEDCSELLTVFHLVFVVHPRGSPQRFTEFAEVDESFSSMKVTYVAERPPSFLGLKMLNFQHLTISEYRTSVGDKEFAIET...
AA_position 187
XM_014327599.1 - Trichosporon asahii var. asahii CBS 2479 - NCBI
PREDICTED: Spodoptera litura uncharacterized LOC111355618 (LOC111355618), mRNA. (2118 bp)
db_xref="GeneID:111355618" /translation="MLPEHFKLEDYRTVCKLLQKNDYMATIDLKNAYYMINIELKYRKYLRFYFDGKLYQFTVLPFGLCTAPLLFTKIFKPILSVIRKRGIRVVQYLDDTCIIAKSYSECKNQVNYILNLFENLGFLVNYKKCNIIPKTECKFLGFIFNSEYMIISIDQEKRQRCVELLSKLKHKISIRFLAQVLGTLVSVCPAIRYGMLYTKHLERIKYLSLLSSNDNFESIITLPNSCQEDIAWWLTNIKTAMCPIRKNKFVLEIETDASLTGWGARCNNKTASGPWTQEEAKLHINMLELHAAFLGLKCFAKDKHDCEILLRIDNTTAISYINRLGGIQHQHLHNISKYIWQWCESKNIWIYASYINTKNNLIADFESRKKIGHTEWELGNKYFKNKYTTCDNLELCSKKAVTLLVLATGHRAQTICAIDIDNIKIETDFVFIQVDKILKTSAPNRMQPFIKLPFFTDRPHVCPAKAVIDYLNITKNIRGDFKNLFLSFKKPYKPVTVSSISRWIKSMLQESGININTFSAHSTRHASTSAALQRGVSIDEIRRTAGWTDSSTCFARFYN...
AA_position 253
XM_022969623.1 - Spodoptera litura - NCBI
PREDICTED: Hyalella azteca cornifin-B-like (LOC108679632), mRNA. (384 bp)
analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108679632" CDS 1..384 /gene="LOC108679632" /codon_start=1 /product="cornifin-B-like" /protein_id="XP_018023778.1" /db_xref="GeneID:108679632" /translation="MAAFRVNAPGYPPAIETDYPPAIETDYPPATEPAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETDYSPATETDYPTATETDYPPATGTGQISIAVYTLQRTC" ORIGIN //...
AA_position 15
XM_018168289.1 - Hyalella azteca - NCBI
Branchiostoma floridae hypothetical protein, mRNA. (1491 bp)
codon_start=1 /product="hypothetical protein" /protein_id="XP_002597018.1" /db_xref="InterPro:IPR006209" /db_xref="GeneID:7207278" /translation="DTDECSSNPCQNGATCHDVANSYTCECEDGWEGLHCDNDTDECSSDPCKNGATCHDGLNSYTCGCVAGWEGLHCDIDTNECSSNPCQNGATCHDEANSYTCECGDGWEGLHCDNDTDECSTDPCKNGATCHDGLNSYTCACVAGWEGNNCDIETDECSSNPCQNGATCHDELNSYTCACVDGWEGIHCDIETDECSSDPCQNGATCHDGLNSYTCACVDGWEGVHCDIETDECLSNPCNNDATCHDGLNSYTCACSNGWEGLHCDIDSDECSSDPCQNGATCHDELNSYTCACVAGWEGTHCDIETDECLSNPCKNGATCHDGLNSYTCECVAGWEGLHCDIDTNDCSSDPCQNGATCHDELNSYTCECVIGWEGTHCDIEIVECTSDPCQNGATCHDELNSYTCECGSGWEGLHCEIDTDECSSNPCQNGATCHDVANSYTCECEDGWEGLHCD...
AA_position 152
XM_002596972.1 - Branchiostoma floridae (Florida lancelet) - NCBI
PREDICTED: Prunus mume uncharacterized LOC103344706 (LOC103344706), transcript variant X2, mRNA. (2547 bp)
LPESVFKKAIQENYNEKKKFKTELTVRQVRKLTALFQPAQVHSTALATRSPVQAKVRDRGVHEGARESLPHAHRDAHARDLYANGDARSYPVLAHERDQHVKYRDVASVRREETSHDLYLTEKEYRAYGLRGERRNVSPCIVPPALEAHHREYEREHLARQPNLIYREAVPAHRENVHNVSPRIVPPALEARHREYERERLARQPNLIYREAVPAHRETVHSDPLYLNDRDYPAYTRGARHELPPATSASAVDAYASDPYYGYSYYGSSSLDPYLAPQRREEVPSGSFSVVGRRENHLIETDPPRRETDRVERLYSTHAFGGRRENYLIETDPVLRRETDRGERLYSMHAAPADAASGYNRTENYQATKADALPAPVSSRYAFAGPSYSYR" misc_feature 858..1226 /gene="LOC103344706" /note="Development and cell death domain; Region: Dev_Cell_Death; pfam10539" /db_xref="CDD:287504" ORIGIN //...
AA_position 543
XM_008248328.2 - Prunus mume (Japanese apricot) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X12, mRNA. (2459 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X12" /protein_id="XP_016700433.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKFKIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLESKQT...
AA_position 124
XM_016844944.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X9, mRNA. (2465 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X9" /protein_id="XP_016700429.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKFKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLESKQ...
AA_position 126
XM_016844940.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X8, mRNA. (2465 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X8" /protein_id="XP_016700428.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKFKIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLESKQ...
AA_position 126
XM_016844939.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107896312), transcript variant X4, mRNA. (2485 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X4" /protein_id="XP_016676946.1" /db_xref="GeneID:107896312" /translation="MALSMAVSRLRNPVLSRALPSLFRARFLSSFASPTPLSRSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKLKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLVKILVPEGSKDVPVGQPIAVMVEDEENITKIPFTLGAGLDVEEKTAHQDVRISEKEEEPSSTNIKASGLPPHIVIGMPALSPTMNQGNIFKWRKKEGEKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKTEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEESKPSPQTSSQKSPSARPESKAPQQSDSFEDLPNTQIRKVIARRLLESKQ...
AA_position 126
XM_016821457.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X11, mRNA. (2462 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X11" /protein_id="XP_016700432.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKFKIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLESKQ...
AA_position 125
XM_016844943.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X10, mRNA. (2461 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X10" /protein_id="XP_016700430.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKFKIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLESKQ...
AA_position 125
XM_016844941.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X7, mRNA. (2468 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X7" /protein_id="XP_016700427.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKFKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLESK...
AA_position 127
XM_016844938.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X6, mRNA. (2468 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X6" /protein_id="XP_016700426.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKFKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLESK...
AA_position 127
XM_016844937.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107896312), transcript variant X3, mRNA. (2488 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X3" /protein_id="XP_016676945.1" /db_xref="GeneID:107896312" /translation="MALSMAVSRLRNPVLSRALPSLFRARFLSSFASPTPLSRSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKLKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLVKILVPEGSKDVPVGQPIAVMVEDEENITKIPFTLGAGLDVEEKTAHQDVRISEKEEEPSSTNIKASGLPPHIVIGMPALSPTMNQGNIFKWRKKEGEKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKTEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEESKPSPQTSSQKSPSARPESKAPQQSDSFEDLPNTQIRKVIARRLLESK...
AA_position 127
XM_016821456.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107896312), transcript variant X2, mRNA. (2488 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X2" /protein_id="XP_016676944.1" /db_xref="GeneID:107896312" /translation="MALSMAVSRLRNPVLSRALPSLFRARFLSSFASPTPLSRSSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKLKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLVKILVPEGSKDVPVGQPIAVMVEDEENITKIPFTLGAGLDVEEKTAHQDVRISEKEEEPSSTNIKASGLPPHIVIGMPALSPTMNQGNIFKWRKKEGEKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKTEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEESKPSPQTSSQKSPSARPESKAPQQSDSFEDLPNTQIRKVIARRLLESK...
AA_position 127
XM_016821455.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Nicotiana tabacum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107817052), transcript variant X1, mRNA. (2394 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X1" /protein_id="XP_016498313.1" /db_xref="GeneID:107817052" /translation="MALSRLRHPVILRAPSLLRARRLLAAGPSNSSTFRSLHHVSGELNQIPDVEATSLRPLHFRLLSGIHDIPSKLQSGVRHLSSAEAPLHTEVAMPALSPTMTQGNIAKWRKKEGDKIEVGDILCEIETDKATLEFESLEEGFLAKILVPEGTKDVPVGQAIAITVEEADDIQKVPATVGGASEVKNQVSSQTDAATGDRPEASPVNISTSELPPHLVLDMPALSPTMSQGNIAKWRKKEGDKIAVGDVLCEIETDKATLEFESLEEGFLAKIVAPEGSKDVAVGQPIAITVEDENDIEEVRTSISGNNVVKEEKTVRQDATAELRTQTTGFNRISPAAKMLIMEHGLDASSIPASGPRGTLLKGDVLVALKSGKGSTKISSIKKETPSPPMVDQQATPTESLGLKSDGQQKDAYEDLPNSQIRKVIAARLLESK...
AA_position 125
XM_016642827.1 - Nicotiana tabacum (common tobacco) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X5, mRNA. (2471 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X5" /protein_id="XP_016700425.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKFKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLES...
AA_position 128
XM_016844936.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107896312), transcript variant X1, mRNA. (2491 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X1" /protein_id="XP_016676942.1" /db_xref="GeneID:107896312" /translation="MALSMAVSRLRNPVLSRALPSLFRARFLSSFASPTPLSRSSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKLKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLVKILVPEGSKDVPVGQPIAVMVEDEENITKIPFTLGAGLDVEEKTAHQDVRISEKEEEPSSTNIKASGLPPHIVIGMPALSPTMNQGNIFKWRKKEGEKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKTEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEESKPSPQTSSQKSPSARPESKAPQQSDSFEDLPNTQIRKVIARRLLES...
AA_position 128
XM_016821453.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X4, mRNA. (2474 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X4" /protein_id="XP_016700424.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKFKVLQLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLLE...
AA_position 129
XM_016844935.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X3, mRNA. (2477 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X3" /protein_id="XP_016700423.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKFKVLQLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLL...
AA_position 130
XM_016844934.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X2, mRNA. (2477 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X2" /protein_id="XP_016700422.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKFKVLQLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRLL...
AA_position 130
XM_016844933.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Gossypium hirsutum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like (LOC107915775), transcript variant X1, mRNA. (2480 bp)
acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial-like isoform X1" /protein_id="XP_016700421.1" /db_xref="GeneID:107915775" /translation="MALSMAVSRLRNPVLSRALPSLLRARFLSSFASPTPLSRSSNVERPFKDWDGSCLSRSNALSTIIGVYGNSSKFKVLQLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNITKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGSDVEEKTAHQDVRNSEKEEEPSSTNIKASDLPPHIVIGMPALSPTMNQGNIFKWTKKEGDKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSASGDSAVKKQEPTQNESKSEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEKSKPSPQTSSRKSPSARPESKAHQQSDSFEDLPNIQIRKVIARRL...
AA_position 131
XM_016844932.1 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Priapulus caudatus uncharacterized LOC106808101 (LOC106808101), transcript variant X4, mRNA. (2137 bp)
GeneID:106808101" CDS 195..1625 /gene="LOC106808101" /codon_start=1 /product="uncharacterized protein LOC106808101 isoform X3" /protein_id="XP_014666162.1" /db_xref="GeneID:106808101" /translation="MDAAKRESLIKNRDEIVERTQPHLAAILARLLEEGVVGQHIYDIISAKPTPAERAAKLVHILLEKDNRTYDVFASALHNNDLADLARKMAATAFEIETDLPANLHAVELHIEEKTLRILEGKLEGRPHSRGGGDSVIEAALHRGKVPPAAHYLSSPPAEIKDLLQKIVVGIGKLRNRRTPGFTLVYGDVETKSESDLTAAAMHVPELWQTTADGQADFPSDVIWQKIDIVRDDAELFLKTKTILSRLDEKYKHHRQPTCLADAHIALQQVLTNNPHCLLILEDVRSFKVIEHFNVHPRTLVTTHDKQLVDRVKQDLTSALVDLVYVGTSSTTYVPNFRDSVFRRSAGPMDAGGSANNGSFVAHDDSTEEPTFAVQPIETDALRTTPKLRPDANYRLHIAHEI...
AA_position 96
XM_014810676.1 - Priapulus caudatus - NCBI
PREDICTED: Priapulus caudatus uncharacterized LOC106808101 (LOC106808101), transcript variant X3, mRNA. (2180 bp)
GeneID:106808101" CDS 238..1668 /gene="LOC106808101" /codon_start=1 /product="uncharacterized protein LOC106808101 isoform X3" /protein_id="XP_014666161.1" /db_xref="GeneID:106808101" /translation="MDAAKRESLIKNRDEIVERTQPHLAAILARLLEEGVVGQHIYDIISAKPTPAERAAKLVHILLEKDNRTYDVFASALHNNDLADLARKMAATAFEIETDLPANLHAVELHIEEKTLRILEGKLEGRPHSRGGGDSVIEAALHRGKVPPAAHYLSSPPAEIKDLLQKIVVGIGKLRNRRTPGFTLVYGDVETKSESDLTAAAMHVPELWQTTADGQADFPSDVIWQKIDIVRDDAELFLKTKTILSRLDEKYKHHRQPTCLADAHIALQQVLTNNPHCLLILEDVRSFKVIEHFNVHPRTLVTTHDKQLVDRVKQDLTSALVDLVYVGTSSTTYVPNFRDSVFRRSAGPMDAGGSANNGSFVAHDDSTEEPTFAVQPIETDALRTTPKLRPDANYRLHIAHEI...
AA_position 96
XM_014810675.1 - Priapulus caudatus - NCBI
PREDICTED: Capsicum annuum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC107850766), transcript variant X2, mRNA. (2411 bp)
residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial isoform X2" /protein_id="XP_016550999.1" /db_xref="GeneID:107850766" /translation="MALSRLRHPLIFRAPSLLRLLPTAHSSFRAFNHVSGALNQIPDVDATSLRPVHFRLLSGVHGIPSKLQNGVRHFSSAETPSYMEVGMPALSPTMTQGNIAKWRKKEGDKIEVGDILCEIETDKATLEFESLEEGYLAKILAPEGTKDVPVGQTIAITVEEADDIQKVPATVGGASEVKNQASSQTDAPGDSVPEASPVNISSSELPPHLVLDMPALSPTMNQGNIAKWRKKEGDKIEVGDILCEIETDKATLEYESLEEGFLAKILAPEGSKDVAVGQPIAITVEDENDIEAVRTSSRGSNVVKEEKSVHHDATAEVRTQPTGFNRISPAAKVLITEHGLDASSIPASGPRGTLLKGDVLAALKSGKGSTNNSPIKMTTPSPPQVNQKASATESLGLKADGQQKDAYEDLPNSQIRKVIAARLLESKQST...
AA_position 119
XM_016695513.1 - Capsicum annuum - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/IETD
lang : en | div : | spe : | query_string : IETD | format : html | download :

0.000 | 0.000 | search_start;
0.590 | 0.590 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:IETD)%7C(nt:IETD)%7C(aa:IETD))?to=0&format=json
1.194 | 0.604 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:IETD)%7C(nt:IETD)%7C(aa:IETD))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
1.199 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]