GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-05-24 11:02:55, GGRNA : RefSeq release 87 (Mar, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Biomphalaria glabrata clumping factor A-like (LOC106075409), partial mRNA. (812 bp)
db_xref="GeneID:106075409" CDS <1..812 /gene="LOC106075409" /codon_start=3 /product="clumping factor A-like" /protein_id="XP_013091805.1" /db_xref="GeneID:106075409" /translation="QGHSENKDHSKNKDHSKNKDHSKNKDHSKNKGHSKNKDHSKNKDHSKNKDHSKNKDHSKNKDHNKNKDHSKNKGHSKNKDHSKNKDHRKNKDHRKNKDHSIEADIKTDIETDIKTDNETDIETDIKTDIETDIKTDIETDIETGIKADIKTDIETGIETGIKTDIETDIETDNETDIETDIETDIETDIETDIETDNETDIETGIETDIETDIETDIEIDIKTDIKTDIETDIKTDIKTDIETDIETDIKTDIETDIETDIETDIEIDI" misc_feature <141..800 /gene="LOC106075409" /note="Ring-infected erythrocyte surface antigen; Provisional; Region: PTZ00341" /db_xref="CDD:173534"...
AA_position 109
XM_013236351.1 - Biomphalaria glabrata - NCBI
PREDICTED: Strongylocentrotus purpuratus mucin-22-like (LOC105437553), mRNA. (3444 bp)
codon_start=1 /product="mucin-22-like" /protein_id="XP_011662571.1" /db_xref="GeneID:105437553" /translation="MGFLMLGSEIREGNTSIVVVVDSAEVVTADKKSQFVEIKGTLVADRQRYISRERREGLSAIDEVEQKVRAATAQETTEDVTTVIVTEMVTELDNEVDTVTDDVTDIITILDKDDENVTATDVSVFGTELITEVVTELGTDKLATEIVTEDSTEIVTIVSEEFTDETEIITDLTRATEEFTEVTEIETDQTEIVTDVTNFVTDVTEEFTDETEIITDLTRATEEFTEVTEIETDQTNIVTDVTNFVTDVTEEFTDETEIITDLTRATEEFTEVTEIETDQTNIVTDVTDFVTDVTEEFTEETEIITDLTRVTEEFTEVTVFETNQTNIVTDVTNFVTDVTEEFTDKTEIITDLTRATEEFTEVTEIETNQTEIITDVTNFVTDVTEEFTEETEIITDLTRATEEFTEVTEIETDQTEIVTDVTNFVTDVTEEFTDETEIITDLTRATEQFTEVTEIETDQTEIVTDVTNFVTDVTEEFTDETEIITDLTRA...
AA_position 185
XM_011664269.1 - Strongylocentrotus purpuratus (purple sea urchin) - NCBI
Malassezia globosa CBS 7966 hypothetical protein MGL_3332 partial mRNA. (2646 bp)
RSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSRTSPRKPHETAAMPHSHRTSSCKTETSVVTSMTTSVDSRGETHTRATTMTTMVPESSCRSMTTPKQTKSCSSMTSVIETDVISTDSKGRKHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISTDSKGRKHTSSTVKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPTSTTRSTVKPSKKSTTSCSSMTSAIETDIIS...
AA_position 362
XM_001729736.1 - Malassezia globosa CBS 7966 - NCBI
Galdieria sulphuraria hypothetical protein (Gasu_26660) mRNA, complete cds. (2170 bp)
hypothetical protein" /protein_id="XP_005706398.1" /db_xref="GeneID:17088646" /translation="MKLLQSFCLLSLCIIFCLSPLLAEAADYERLCHCFQQDTSAFDLYKLVGTYSVTSCSSCNEKNCAALFGEQESDYNKLCAYIGESVVDAVESVLEGDFKSAETYMQDLISNQTTLIENYIDKLLGYLNNTLDGFRNEVGTNITVIEQEINEINTTFIAQDIQEAVTQIENYVSKDINEAITSLEVQIQKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNVTSDIDQAINTLKEFVDSVSVDVEANISLDINKAVKTLQ...
AA_position 205
XM_005706341.1 - Galdieria sulphuraria - NCBI
PREDICTED: Prunus persica dr1-associated corepressor (LOC18789907), mRNA. (1488 bp)
db_xref="GeneID:18789907" /translation="MAEEQNAAREEENAEQREENAEQAEENAEQEEENAEQADENAEQEEDDAEQEEDNSEKAVENAAVKEKAKVAQEEENAEPIRSENSQIRPEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEVATEKKRKIVKLEHMRVAVKRHRPTSDFLLDELPVPSQPSDHQPTDRSSSRTVSHAPAPARRDRSRSRAVSYKPAPAGTRRIDHFFRTKEIPIQTEQSLIETEEAPIETEEASIEIDEAPIETDEGPIETDEASIETDEASIETDEASIETDEAPIVTDEGPIETGEGPIETNES" misc_feature 546..737 /gene="LOC18789907" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 256
XM_007227173.2 - Prunus persica (peach) - NCBI
PREDICTED: Stylophora pistillata uncharacterized LOC111332102 (LOC111332102), transcript variant X2, mRNA. (4985 bp)
introns" /db_xref="GeneID:111332102" CDS 98..4513 /gene="LOC111332102" /codon_start=1 /product="uncharacterized protein LOC111332102 isoform X2" /protein_id="XP_022793107.1" /db_xref="GeneID:111332102" /translation="MMFDPFNPSPEPAIESDEDTMSPRERNASTDVNSMTLSSEHSFTPPSSTDQNDLSSMTGEEYREDNGNSAECNSSIETDMTVLREPYREENAEGPFNPSPGPAIESDEDTVPPREKDASSVVISITTSSEHPSTTPSSSDRNELPSMNGEENQEDNGSSAECNSSIETDMTVLRESYRDDNAEGPSSPSPAPTFESDEDTVPQREKDASSDVDSMTPSSEHSSTPPSSTDENCLPFMPGEENQEAKGSSADSKSSIETDITVLEEPYRGDNREGPFILIPGPVIENDKDTEPPLNKDASTDVNNMTTSSEHSSSPPTSTGQNNLPFITMEEYREDNGNSAETKSSIETDMTMLEVPNRSENREGLFTLSPAPAIESDENTAPPR...
AA_position 76
XM_022937372.1 - Stylophora pistillata - NCBI
PREDICTED: Stylophora pistillata uncharacterized LOC111332102 (LOC111332102), transcript variant X1, mRNA. (5165 bp)
introns" /db_xref="GeneID:111332102" CDS 98..4693 /gene="LOC111332102" /codon_start=1 /product="uncharacterized protein LOC111332102 isoform X1" /protein_id="XP_022793106.1" /db_xref="GeneID:111332102" /translation="MMFDPFNPSPEPAIESDEDTMSPRERNASTDVNSMTLSSEHSFTPPSSTDQNDLSSMTGEEYREDNGNSAECNSSIETDMTVLREPYREENAEGPFNPSPGPAIESDEDTVPPREKDASSVVISITTSSEHPSTTPSSSDRNELPSMNGEENQEDNGSSAECNSSIETDMTVLRESYRDDNAEGPSSPSPAPTFESDEDTVPQREKDASSDVDSMTPSSEHSSTPPSSTDENCLPFMPGEENQEAKGSSADSKSSIETDITVLEEPYRGDNREGPFILIPGPVIENDKDTEPPLNKDASTDVNNMTTSSEHSSSPPTSTGQNNLPFITMEEYREDNGNSAETKSSIETDMTMLEVPNRSENREGLFTLSPAPAIESDENTAPPR...
AA_position 76
XM_022937371.1 - Stylophora pistillata - NCBI
PREDICTED: Drosophila serrata DM7 family protein GG19680-like (LOC110184807), mRNA. (3021 bp)
FELPADIFPVDINRPGPRFLPQRFLPDFCDAGCVFPPGSLPDSVFHGAIRTHYDLEQHHYSMTPPLFVGQCKQQQEQPCDNGTVQVYKIDPVAMQLKKLALRNMAATKKDTTKIPVPLPEGTKRSHDFKLAAQAGKPKGFVLIESDHVPRGAIPTDFFGAFLMGCFFMIAPNNKGVTQSSSESEDDEEDEQEFLDFQNNMFTMVKLNRGSLAGVPAVEKTEVQKAEVKEPETEESEAELNSEEYETEEYLDEDCESEGYEAEEIDTDEYEAEVRRIEEIDPDEIDTDEYEAEEVDPDEIETDEYEADEDKTEELDPDEIETDEYEAEEGKTQELNQDEIETDEYEADEGKIGELNPIEIETYEYKADEGKTKELNQGDIETDEYEPVEAKTKEVNQDEIETDEYEPVEANTKELNQDDIETDEYDPEQADGKKPKVVQKSDIAEPPAKEPSLKRKHTNTDNEYTNRIAPDYTGCDKVYSYFTIDSNLDDIAEAAGDLTTARFEVIVHASELPGIDVNRAVEQFRQVLQCRNEIRAKMTGLINAHDAKMEADHKVVLVSPVPEVNTKRVFRKTCSQCGKNH" misc_feature...
AA_position 623
XM_020953443.1 - Drosophila serrata - NCBI
PREDICTED: Plutella xylostella probable GPI-anchored adhesin-like protein PGA55 (LOC105397220), mRNA. (1771 bp)
db_xref="GeneID:105397220" /translation="MDPAIIFPSHLFDQSFGMCITPQDLILPTNNIINPNYHRPWKWYIENISKDSGSTIESDKNKFQVTLDVQHFKPDEISVTVINKEIIIEGKHGERLDDHGVVSRQFLRRYALPVDCDSDDVTANLSSDGILMVCAKKKMIQNLTNERQVHIQLCDSLLTKEVKSNLSSKTSDEEMNKSQIKKQDEKCDINIKCEKSKQEAEEKSNMKSSSLDDSRHSKNSQLMLREDHSRLLKPEFLGETLSNVGGTIIKESKIETDELLEMSSSRAGKANVEGTTKETKKIETDEHLEMSSSRIGGTITGAKIETDELLEMSSSRFGMGNVGGTIKAKIETDELLEMSSSRIGGTITGAKTETDELLEMSSSRFGKGNVGGNIKEAKIETDELLEMSSSRIGGTITGAKTETDELLEMTSSRFSKGNIGEIIKEAKIEADELLEMSSSRVAKAMDSISAISDEMLNMAIGNAYQSSMMATEESSTISSEKMSSGSMALSEESMKVVSETGQSSMETTSEKASFSSSSMSSEVVSSQESSSLMSSMSSSVKASSEIATSELLSDRISAA...
AA_position 254
XM_011569231.1 - Plutella xylostella (diamondback moth) - NCBI
PREDICTED: Xenopus laevis uncharacterized LOC108695696 (LOC108695696), mRNA. (6063 bp)
KQKETDTKQNEAVTEHGNTTVKYEQYESENEQWQTATEQWETDREEGTTDTHDIHPLIAQKMDRERDTEETANQSRRETLSEDSEEWETASDDSIDRPVLVQNEETVDWVIREVREIMREREVEDSEDLNTISHGIQTASLTSHEVTDTIREGETVVDKRTSVNESETGETGGTLAMNNEDNVLETIRDGTTETGTEGSVTQPEERQQETEGTAVKIGEQWDLLEERKDTSAEIMAPSKTTERQESEMEKLEQEEIPEESQEDGIVIERGLCNLLGTDTRVQGQGLLETDTGVQGQGLIETDTGVQGQGLIETDTGVQGQGLTETDTGVQGQGLLETDTGIQGQGLLETDTGVQGQGLIETDTGVQGQGLIETDTGVQGQGLIETDTVVQVQGLLETDTGVQGQGLMETDTGVQGQGLTETDTGIQGQGLLETDTGVQGQGLLETDKGVQGQGLIWTDAEVQGQGLLETDTGVQGQGLLEIDTGVKGQGLLETDTGVQGQGLLEIDTGVKGQGLLKTDTGVQVQGLMETDTGVQGQGLLGTDTGVQGQGLLETDTEVQGQGLLETDTGVQGQGLMEQEITCQFGDVTKQSLDHKSAEKVH...
AA_position 599
XM_018224672.1 - Xenopus laevis (African clawed frog) - NCBI
[Candida] auris hypothetical protein (QG37_04037), partial mRNA. (4047 bp)
GeneID:28877770" /translation="MTTSTSLLPVPFTTYTSTWTITNSDGSQATDSGIVIVTTDSEGQLTTTTSVIPPPFTTYTSTWTTTGANGGEETDSGVIIVTTDSDGQLATTTSVIPPPFTTFTSTWTTTNSDGNQATDSGVVIVTTDSDGQLTTTTSVIPPPFTTYTSTWTTTGADGSEETDSGVIIVTTDSAGQLTTTTSVIPPPFTTFTSTWTTTDGNGNEGTDSGVIIVTTDSDGALTTTTAVIPPAAGSGTDALSSSIDDVPYTTYTSTWTTTDGNGNIETDSGVVIVTTDSEGSLTTTTSIIDSPFTTYTSTWATTDNNGNVETDSGVVIVTTDSNGQLTTTTSVIDSPYTTYTTSWPTTDANGGVETDSGVVIVTTDSNGQLSTTTSVIDSPFTTYTTSWPTTDGNGAVETDSGVVIVTTDSNGQLTTTTSVIDSPYTTYTTSWPTTGADGAVETDSGVVIVTTDSDGQLTTTTSVIDSPYTTYTSIWTTTDSVGNVETDSGVVIVTTDSDGQVTTTTSRFENSPSDLTEYTTTWASTDSDGNIKTDSGVVVVTTDSAGSTTTSTSTFDTPYTTFTSTWTTT...
AA_position 264
XM_018313382.1 - [Candida] auris (Candida auris) - NCBI
PREDICTED: Lingula anatina uncharacterized LOC106157898 (LOC106157898), mRNA. (1046 bp)
GeneID:106157898" CDS 72..1046 /gene="LOC106157898" /codon_start=1 /product="uncharacterized protein LOC106157898" /protein_id="XP_013389147.2" /db_xref="GeneID:106157898" /translation="MKVVIAVIFLAGAVLGQQSREERCQLLEEKGCQDRWKVNNLRICGSDKQMYTSWCAFITAQCADDDLKMDRNIRHCLQGQLNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRMNRPTRLCASNGKMYTTGCDFFKARCEDATLKIDRNIRHCQSQVNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRMNRPIRLCASNGKMYTTSCDFTKARCEDPALRVDWNIRHCQSQVNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRLNRPTRLCASNGKMYTTGCDFVKARCEEPSLKLDRNLNHCRQDE" ORIGIN //...
AA_position 110
XM_013533693.2 - Lingula anatina - NCBI
PREDICTED: Camponotus floridanus uncharacterized LOC105255116 (LOC105255116), mRNA. (2217 bp)
alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:105255116" CDS 307..2115 /gene="LOC105255116" /codon_start=1 /product="uncharacterized protein LOC105255116" /protein_id="XP_011262511.2" /db_xref="GeneID:105255116" /translation="MNMTKHPLYETSTDSTENIITSTSIETDSTEDITTSTSIETDSTEDITPSTSIETDSTENKTTSTSIETDSTEDTNDTKPSAPTNSPDDDDTASFTFINFHPHISDVTSADNQAETLKVEFEELRRNDDNLHKFTEMAIFRNHYMFPTVPNTVLSKQKNTLKSVLNQKSSKTNEDIAISTKQKLEKKDHISKNKHCKKPQSLVLWRPLAPPIQDLEEKSRIYKLLMKHVFTRESRLIFNYKRERRSSLPFTPIPKLLAICPPPPESTTSELLNVIEKPNTSKSDINLDSQSSKTCIFTKQAKIKTPKDSTNESNSSTDDESYIDTEQSTHS...
AA_position 25
XM_011264209.2 - Camponotus floridanus (Florida carpenter ant) - NCBI
PREDICTED: Astyanax mexicanus titin-like (LOC103031050), mRNA. (5686 bp)
AVPAETIILTNTETPKLAQTGNFFKMFKKKNEPVIPEPEVTLDVSVQQNSELPALILTDNALPTPEPVPAAVVSVEVSPDPAVPAETIILTNTETPKPVQTANFFKMFKKKNDPVIPEPEVSLDVSVQQNSEPPAMILTDNALPTPEPVPAAVVSVEVSPDPAVPAETITLTNTEPIKPVQKPSLFNRFKKKNEPAIPEPEVSLDVSVQQNSEPPSIILTDKALPTPEPVPAAVVSVEVSPVPAVPAETITITNTGTPKPAQKPSLFNRFKKKNESVIPEPEVSLEVSVQQNSDLPTMIETDNALPAPEPVPAAVVSVEVSPDPAVPAETITLTNIEPPKLAQKPSLFNRFKKKNEPVIPEPEVTLDVSVQQNSDLPTMIETDNALPTPEPVQLQSYLWKFKKKNEPVIPEPEVSLDVSVQQNSEAPSIILTDKALPTPEPVPAAVVSVEVSPVPAVPAETITLTNTEPPKLAQKPSLFNRFKKKNEPVIPEPEVSLGVSVQQNSEAPSIILTDKALPTPEPVPAAVVSVEVSPVPAVPAETITLTNTEPVPAAVVSVEVSPVPAVPAETITLTNTETPKPAQKPSLFNRFKKKNEPVIP...
AA_position 380
XM_022676745.1 - Astyanax mexicanus (Mexican tetra) - NCBI
PREDICTED: Prunus avium retrotransposon-like protein 1 (LOC110769621), mRNA. (1268 bp)
translation="MAEEQNAAREEDNIAPEENAEQGEENAEQEEENAEQEEENAEQEEENAEQGEEKAEQEEEDAEKAEENAEQEEDDAEQEEDNAEQEEDNPEKAVEKAAVKEKAKVAQEEENAEPIRSENSQIRAEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEIAMEKKRKIVKLEHMRVAVKRHRPTSDFLLDELPVPSQPSDHQPTDRSGSRTVSHAPAPAREDRRRSSAVSDKPAPAGTRRIDHFFRAKEIPIQTEKSLIETDEASIEIDEAPIETDEGPIETDEAASIEMDEAPIVTDEGPIETGEGSIETNKS" misc_feature 373..564 /gene="LOC110769621" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 269
XM_021973644.1 - Prunus avium (sweet cherry) - NCBI
PREDICTED: Hyalella azteca cornifin-B-like (LOC108679632), mRNA. (384 bp)
analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108679632" CDS 1..384 /gene="LOC108679632" /codon_start=1 /product="cornifin-B-like" /protein_id="XP_018023778.1" /db_xref="GeneID:108679632" /translation="MAAFRVNAPGYPPAIETDYPPAIETDYPPATEPAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETDYSPATETDYPTATETDYPPATGTGQISIAVYTLQRTC" ORIGIN //...
AA_position 15
XM_018168289.1 - Hyalella azteca - NCBI
Verruconis gallopava hypothetical protein mRNA. (1369 bp)
locus_tag="PV09_09831" /codon_start=1 /product="hypothetical protein" /protein_id="XP_016208194.1" /db_xref="GeneID:27317804" /translation="MKGLIGCLEADDMDKMMTALSEARADEVLQNDTESTVQTLVLSQEAEGPTLRMQVLDALQSLAQIHIMHEMMVLKLQTEVGVGNSRTLTLETFKTNQNNMNERISFLIGSLEADDMDKMRTALEEADAVRTAVNENITKTATLLQESLIETDNDKAKEVPKIETDSGIEVEPASQIKEE" ORIGIN // REFERENCE 1 (bases 1 to 1369) AUTHORS Cuomo,C., de Hoog,S., Gorbushina,A., Stielow,B., Teixiera,M., Abouelleil,A., Chapman,S.B., Priest,M., Young,S.K., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE The Genome Sequence of...
AA_position 149
XM_016363977.1 - Verruconis gallopava - NCBI
PREDICTED: Xenopus laevis fucolectin-1-like (LOC108719451), mRNA. (961 bp)
and 96% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:108719451" CDS 197..961 /gene="LOC108719451" /codon_start=1 /product="fucolectin-1-like" /protein_id="XP_018123792.1" /db_xref="GeneID:108719451" /translation="MRNSANLKYAGSYFYVLAVNLARSGDVRQSSTYEPHYSAETAIDGIIETDISIHPCSHTSSDNPAWWRLDLKKIYKVDSVVIVNRMDCCSERLMGAQIHVGDSADNKNPVCGTIFDISKATITILCNGLEGRYVSVVIPGREEYLTLCEVEVYGRESNNVKAVNLARTGEVTQSSSYESHYSAETAIDGIIETDISIRPCSHTNDDNPAWWRLDLKKVHKVDAVAIVNRMDCCSERLLGAEIRVGNSADNNNPV" ORIGIN //...
AA_position 47
XM_018268303.1 - Xenopus laevis (African clawed frog) - NCBI
Nematostella vectensis predicted protein (NEMVEDRAFT_v1g63537) partial mRNA. (348 bp)
dev_stage="larval" gene 348 /locus_tag="NEMVEDRAFT_v1g63537" /db_xref="GeneID:5520424" CDS 348 /locus_tag="NEMVEDRAFT_v1g63537" /codon_start=1 /product="hypothetical protein" /protein_id="XP_001640177.1" /db_xref="GeneID:5520424" /translation="LHIDKEELYIDSDELHIDTSKSHIDTDELYIDTDELHIDTDEIHLDTDKFHIETDDLHIDIDELHIETYELHIDTDERVVLDTDELHIDTDEIHLDTDKLHIETDELHIDTDELHI" ORIGIN // REFERENCE 1 (bases 1 to 348) AUTHORS Putnam,N.H., Srivastava,M., Hellsten,U., Dirks,B., Chapman,J., Salamov,A., Terry,A., Shapiro,H., Lindquist,E., Kapitonov,V.V., Jurka,J., Genikhovich,G., Grigoriev,I.V., Lucas,S.M., Steele,R.E...
AA_position 52
XM_001640127.1 - Nematostella vectensis (starlet sea anemone) - NCBI
PREDICTED: Rhagoletis zephyria dehydrogenase/reductase SDR family member 4-like (LOC108356739), partial mRNA. (696 bp)
CDS <1..696 /gene="LOC108356739" /codon_start=1 /product="dehydrogenase/reductase SDR family member 4-like" /protein_id="XP_017463329.1" /db_xref="GeneID:108356739" /translation="TLKHFGGIDIFVSNAAVNPAKSHILETSDEVFEKILAVNLIAPFSLSKDIVPHMVKRGGGNIIYIGSASGYMYQGAQNLSERMAAYAISKTALLGLTKAVAGKCAPLNIRVNCVAPGLIETDFAVSITGSPDYPGSFLPLQXATSSTSAAPPGAPLNIRVNCVAPGLIETDFAVSITGSPDYPGSFLPLQTIKRIGRAEEVAGMVAFLCSKDASYISGETCTVAGGNGTRL" ORIGIN //...
AA_position 119
XM_017607840.1 - Rhagoletis zephyria (snowberry fruit fly) - NCBI
Plasmodium reichenowi rhoptry-associated membrane antigen, putative partial mRNA. (2682 bp)
codon_start=1 /product="rhoptry-associated membrane antigen, putative" /protein_id="XP_019970605.1" /db_xref="GeneID:24530305" /translation="MNVLLLSLLVVQNIVTYLEQIKNGISGHYVEDHNIKNDNCISFSDYERSIKNFSISSHAENNYDNIINEYKKIKDINNNINILSSVHRKGRILYDNFLEINNLENEKKENDEKEDEYEYEDNDESFLETEEYEDNEDEKYNNDEDDYAESFIETDKYEDNEDDKYNKDEKYNKDEKYNKDEDDYAESFIETDEYEDNKDDKYNKDEDNYSESFIETDEYDDNEEEQYNKDEDGYADSFIETDHYGNNDDKNEEEEEEYNDQDNDYGYNFLETDEYDDSEEYDYDDNEYGESFLEKEEGEEMKDEEMKYDEMKDDQMNYDEMKDEEIKDDEMKYDEMKDEEMKYDEMKDEEMKYDEMKDDEMKNDEMKYDEMKDEQMKDEQMKDEQMKYDEMKDEQMEYEEFKNEDKKKEDMSYDEYMGYKKKEQEESYNTYNGNKKNKTSDSFLEKDLQGNSDDELHST...
AA_position 152
XM_020114648.1 - Plasmodium reichenowi - NCBI
PREDICTED: Lingula anatina uncharacterized LOC106156340 (LOC106156340), partial mRNA. (720 bp)
samples with support for all annotated introns" /db_xref="GeneID:106156340" CDS <1..568 /gene="LOC106156340" /codon_start=2 /product="uncharacterized protein LOC106156340" /protein_id="XP_013387003.1" /db_xref="GeneID:106156340" /translation="CDFFKARCEDATLKIDRNIRHCQSQVNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRMNRPIRLCASNGKMYTTSCDFTKARCEDPALRVDWNIRHCQSQVNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRMNRPTRLCASNGKMYTTGCDFVKARCEEPSLKLDRNLNHCRQDE" ORIGIN //...
AA_position 55
XM_013531549.1 - Lingula anatina - NCBI
Kwoniella dejecticola CBS 10117 hypothetical protein partial mRNA. (924 bp)
CBS:10117" /db_xref="taxon:1296121" /chromosome="Unknown" gene 924 /locus_tag="I303_06277" /db_xref="GeneID:28969976" CDS 1..924 /locus_tag="I303_06277" /codon_start=1 /product="hypothetical protein" /protein_id="XP_018261832.1" /db_xref="GeneID:28969976" /translation="MAPTKRAAHSGTSALEPPIETDQVHTTETSTLATDPLPVVKVNNANLGEIKAALDDIVKKHLQDQSFTPSLLHPTVHLSLGYSSVILALASVLYSLKVEFEDSKPVLWVAVVGYTVLQTALWGWKRWVEKGEVFKGRRRRMVKRIETDHIQILSSTSLSPPPLPNISFSPHTRPSSPSSPSSPSSPSSPSSPSSPRLNSTSSSRASIPSPLPIAAAIPTPAEIAQAGETNGTDGPSYILQMTLSITSNNGKSLIHKSKSTVGRSIGLMIDEEGGVEQGQVIRWLTAALGEAGLGGLDELNGANGKDE" ORIGIN // REFERENCE...
AA_position 19
XM_018409559.1 - Kwoniella dejecticola CBS 10117 - NCBI
Kwoniella dejecticola CBS 10117 glycerophosphodiesterase partial mRNA. (1134 bp)
I303_08537" /db_xref="GeneID:28972236" CDS 1..1134 /locus_tag="I303_08537" /codon_start=1 /product="glycerophosphodiesterase" /protein_id="XP_018258995.1" /db_xref="GeneID:28972236" /translation="MSIHQEINNVSRPESTLPTPALSPSNSVGPSPAFSTVLQSPAVSEFELENPFDKLEVSPDGKNDHWQIPECWGHRGASASFPENTKASFVEACKAGADGIETDIHITADNVLVMFHDPELHRTTDGEGLIHKQPWKGVLEHVRTTKAPHQPIPKFTEVLEILLQPENLNVKLNIDCKVENDPIKLFTLIKGVVEEFEGWQTKLAPRLILGIWHPKFITPAVTILPYLPRYAITMSIDQCRKYFFETCHGFSVMYPALASSEGAKFRKECQAKGKWICAWTVNDVEEMKSCGRWGIRSVISDKPELWREIRKEIETDRVKALKPTLQSLIQPFLSAKYYSFHHQRLAREETEYLEREGGTFDIVLPEISLGIAKPSIQ" ORIGIN // REFERENCE 1...
AA_position 100
XM_018411794.1 - Kwoniella dejecticola CBS 10117 - NCBI
PREDICTED: Ceratina calcarata jerky protein homolog-like (LOC108622191), transcript variant X1, mRNA. (4441 bp)
NEIILLWKALPTKTHVGNSKQSISGLKLNKERIMLVLCANASGTHKIKPLVVSNYQNPHALKEKDNLLLIHEQSKKTWKNTNLFTVWYENDFKSSTKSHQLQKGVSGKIYLLLDNCSDHKKVDAEDENFQIMHSPPDTSLIQPMTEGVIDKIKTCFRHKLMKEFLRYSNGEEEFYQKYSINDCINMVAESWEDILYTKNNIKNTWKEHVDEREEISEEKKDKEKHEENILNEMQDMMRIILERNTTMEDVIRFLTECRLEEIYFLNQNDEENTSDIYENDEENRLVIDESDDENKLVIIETDDQNRDEIHENEEENKDKSHENDEENRHVIDENDDENKLIITETDDQNRDEIYENEEENTDEIHENDEENRLVIDESDDENKLVIIETDDQNRDEIHENEEENKSKIHENDEGNRNKNNENRNDEIGTTDKGEKLTAADIKLNPEEREEMKYIFERLEYYYPRLPHAIKYYLQACKSACIGEPIDVKYSVH" ORIGIN //...
AA_position 388
XM_018019900.1 - Ceratina calcarata - NCBI
PREDICTED: Harpegnathos saltator uncharacterized LOC105188109 (LOC105188109), mRNA. (6358 bp)
ISEEQPLFDLKYPIVKEANASAAFENINNITGMDEKATETVTHATDKMPPRRTRIYSDKRINLMFKHNQNALNDASEASTNSTLRDNITEKAINFCERSNRKVKSTTTTEEGLTDKCSTETDIDEKATKSVTHTTDKMPSRRTRFYSDKRISQMCKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSMITTEEDFTNKCSTEIDIDEKATKSVTHTTDKMPPRRTRFYSDKRISQMCKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSTTTTEEDFTDKRSIETDINERAAKSVTHSTDKMPPRKTRIYADKRISQMFKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSTTTTEEDFTDKRSIETDINERAAKSVTHSTDKMPPRKTRIYADKRISQMFKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSTTTTEEDFTDKRSIETDINERAAKSVTHSTDKMPPRKTRIYADKRISQMFKQNQNALNNALQTPTNSTLQDNITEKSTNFCERSNGRVKSMITTEEDFTNKCSTEIDIDEKATKSVTHTTDKMPPRRTRFYSDKR...
AA_position 421
XM_011149400.2 - Harpegnathos saltator (Jerdon's jumping ant) - NCBI
PREDICTED: Sinocyclocheilus grahami dachshund homolog 1-like (LOC107600400), mRNA. (646 bp)
gene="LOC107600400" /codon_start=1 /product="dachshund homolog 1-like" /protein_id="XP_016147783.1" /db_xref="GeneID:107600400" /translation="MCTPTARDSYERLSFAGQTLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMELFRERELRETLEKQLAVEQKNRAIIQKRLKKEKKAKRKLQEALEYESKRREQAEQSLKQTSTTESLRSLNDSLTQEIETDRSSGRTDAERTIQDSLTQEIETDRSSGRTDAERTIQACCSCIQPAIWAADPTVQEEGQDQ" ORIGIN //...
AA_position 149
XM_016292297.1 - Sinocyclocheilus grahami - NCBI
PREDICTED: Theobroma cacao dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC18586597), transcript variant X3, mRNA. (2199 bp)
GeneID:18586597" CDS 186..1838 /gene="LOC18586597" /codon_start=1 /product="dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial isoform X3" /protein_id="XP_007010139.2" /db_xref="GeneID:18586597" /translation="MPALSPTMSQGNIAKWKKKEGDKIEVGDVLCEIETDKATLEFESLEEGFLAKILVPEGSKDVPVGQPIAITVEDADNIQKIPSSLGSGSDVEEKTAHQDVRNSGKDEEQSSVNINALDLPPHIVIGMPALSPTMNQGNIFKWRKKEGDKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGEPIAVTVENPDDIEAVKTSVGGGSGVKMQKPTHHESKSEVREQKFGFTKISPSAKLLISEYGLDASSIKASGPHGTLLKGDVLAAIKSGKGSSKISSSEKIKTSPEASPQKSTSARLESKTQPQQSDSFEDLPNTQIRKIIAKR...
AA_position 33
XM_007010077.2 - Theobroma cacao (cacao) - NCBI
PREDICTED: Quercus suber laccase-14-like (LOC112011830), mRNA. (942 bp)
feature by RNAseq alignments" /db_xref="GeneID:112011830" CDS 1..942 /gene="LOC112011830" /codon_start=1 /product="laccase-14-like" /protein_id="XP_023899937.1" /db_xref="GeneID:112011830" /translation="MASYMPTNISGIYTADFPDNPPSFFNFTEDDSPDDTTLSVQGTKVRMLNYNEEVEIVFQGTNLLDVSMDHPMHLHGYSFYVIGSGYGVFDIETDPKGYNFDDPPKLNTVTLPKNGWVAIRFKASNPGMNISGIYTADFPDNPPSFFNFTEDDSPDDTTLSVQGTKVRMLNYNEEVEIVFQGTNLLDVSMDHPMHLHGYSFYVIGSGYGVFDIETDPKGYNFDDPPKLNTVTLPKNGWVAIRFKASNPGVWLWHCHYERHLSWGMSSVFIVKNGGTSETSIREPPPYLPPCKDSFTSRLLQYENSDGNRLNKID" misc_feature 46..384 /gene="LOC112011830" /note="Multicopper oxidase; Region: Cu-...
AA_position 91
XM_024044169.1 - Quercus suber - NCBI
PREDICTED: Raphanus sativus uncharacterized LOC108815750 (LOC108815750), mRNA. (2716 bp)
AVKVTRQNPSGLLLDYCMPDSTLLSRVLDGIGHDCWSVFVDAAVKVEKRELPGENCLNHELLLENGSLELEEGLEAEKTRKKRELELSDGEKSRKKTKVDVDESHELFGNVQLEVVATESSPLDDTLPETTRKETEMCVEDVGIVNADTDNLVSHQANHLDSSSGLATRSEDDINQSSAAALTTSNVESVAAAPESLPASGGENGGNPFAEASQKDKIGTDDVVNHMENHLDTNIGLTARPDTEKKSSEVDTNQTSATANVEERVDATPAASLPVSRGENQKENELVQISLDDVGRGQIETDNLVSHTSNHLDTVSAVTTRPDTEKKKRRKKRSKDVISQSFSASITTSRDIVNEIKGVPANVDSVDATLESLPVSTRENPSTEARHKETETGENSGGPTPLAGGARATACFFNIIVQRFKDAEIEKNETEENNASLEVADSQELSDEVNNAALEVAQSQELSVEVNNAAMEETPLMKNPQDTENLDDSFAEAIQKENELVQISIDDVGRGQIETDIHTSNYLDTVSAVTTTPVTEKKKGRKKRSKDVISQSFSASITTSRDIVTRKTRKSKTPAEEDTLVVSSEAHNVEPIKAVEGEEP...
AA_position 355
XM_018588253.1 - Raphanus sativus (radish) - NCBI
Plasmodium falciparum 3D7 rifin-like protein (RAMA), partial mRNA. (2586 bp)
rifin-like protein" /protein_id="XP_002808767.1" /db_xref="GeneID:9221885" /db_xref="GOA:C0H4M0" /db_xref="UniProtKB/TrEMBL:C0H4M0" /translation="MNVLLLSLLVVQNIVTYLEQIKNGISGHYTEDHNIKNNNCISFSDYERSIKNFSISSHAENNYDNIINEYKKIKDINNNINILSSVHRKGRILYDSFLEINKLENDKKEKHEKEDEYEDNDESFLETEEYEDNEDEKYNKDEDDYAESFIETDEYEDNEDDKYNKDEDDYSESFIETDEYDDNEEEQYNKDEDDYTDSFIETDHYENNDDKNEEEEEYNDQDNDYGYNFLETDEYDDSEEYDYDDKEYGESFLEKEEGEEMKDEEMKDEEMKDVEMKDEEMKDEEMKYDEMKNEEMKYDEMKDEVMKDEEMKDEVMKDEEMKDEQMKYEEFKNEESKNEESKNEESKNEESKNEEFKNEESKNEEFKNEEFKNEDMSYDEYMGYKKKEEDESYNTFNGTKKNNTSNSFLEKDLQGDSDDELHSTFYSKNVDKENYDDKNIFYGYSDNDDESFLE...
AA_position 150
XM_002808721.1 - Plasmodium falciparum 3D7 - NCBI
PREDICTED: Theobroma cacao dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC18586597), transcript variant X2, mRNA. (2313 bp)
residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial isoform X2" /protein_id="XP_017985049.1" /db_xref="GeneID:18586597" /translation="MALSRLRNPVISRAAPSLFKARFLSSYASPRSLSRTLNVESPFKDFNGSLLRPNSLSTIIGVCSTSSILKLQIGVRHFSSADLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEVGDVLCEIETDKATLEFESLEEGFLAKILVPEGSKDVPVGQPIAITVEDADNIQKIPSSLGSGSDVEEKTAHQDVRNSGKDEEQSSVNINALDLPPHIVIGMPALSPTMNQGNIFKWRKKEGDKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGEPIAVTVENPDDIEAVKTSVGGGSGVKMQKPTHHESKSEVREQKFGFTKISPSAKLLISEYGLDASSIKASGPHGTLLKGDVLAAIKSGKGSSKISSSEKIKTSPEASPQKSTSARLESKTQPQQSDSFEDLPNTQIRKIIAKRLLESKQ...
AA_position 123
XM_018129560.1 - Theobroma cacao (cacao) - NCBI
PREDICTED: Theobroma cacao dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC18586597), transcript variant X1, mRNA. (2316 bp)
residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial isoform X1" /protein_id="XP_017985048.1" /db_xref="GeneID:18586597" /translation="MALSRLRNPVISRAAPSLFKARFLSSYASPRSLSRTLNVESPFKDFNGSLLSRPNSLSTIIGVCSTSSILKLQIGVRHFSSADLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEVGDVLCEIETDKATLEFESLEEGFLAKILVPEGSKDVPVGQPIAITVEDADNIQKIPSSLGSGSDVEEKTAHQDVRNSGKDEEQSSVNINALDLPPHIVIGMPALSPTMNQGNIFKWRKKEGDKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGEPIAVTVENPDDIEAVKTSVGGGSGVKMQKPTHHESKSEVREQKFGFTKISPSAKLLISEYGLDASSIKASGPHGTLLKGDVLAAIKSGKGSSKISSSEKIKTSPEASPQKSTSARLESKTQPQQSDSFEDLPNTQIRKIIAKRLLESK...
AA_position 124
XM_018129559.1 - Theobroma cacao (cacao) - NCBI
PREDICTED: Raphanus sativus dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC108829816), mRNA. (2338 bp)
residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial" /protein_id="XP_018458905.1" /db_xref="GeneID:108829816" /translation="MVLPLLRRAAIARTSSLLRARLLAPASGFHTRFSNGVYHLDDKISSSHGARSASIDMITRMDNSHPKSIVRFGMQNFSSTGPVPQTVLTMPALSPTMSHGNIAKWLKKEGDKVEVGDVLCEIETDKATVELESQEEGFLAKIIVTEGSKDIAVNAPIAIMVEEEDDIQNVSAPGEGGQVGKEETSAHQEKKPEESTQQGGSIQPDASDLPPHVVLEMPALSPTMNQGNIAKWWKKEGDKIEVGDVIGEIETDKATLEFESLEEGYLAKILIPEGSKDVAVGKPIALIVEDAESIEAIRSSSAGGSEAVTEKQAPQSVVDKSGGKKAGFTKISPAAKLLILEHGLESSSIEASGPYGTLLKSDVVAAIASGKTSKKSVSTEKKQPSKENLSKSSSVSRPESKSSVTPSNDYEDFPNSQIRKIIAKRLLESKQKIPHLYLSSD...
AA_position 122
XM_018603403.1 - Raphanus sativus (radish) - NCBI
PREDICTED: Gossypium arboreum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC108489353), transcript variant X2, mRNA. (2480 bp)
residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial isoform X2" /protein_id="XP_017649336.1" /db_xref="GeneID:108489353" /translation="MALSMAVSRLRNPVLSRALPSLFRARFLSSFASPTPLSRSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKLKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGLDVEEKTAHQDVRISEKEEEPSSTNIKALGLPPHIVIGMPALSPTMNQGNIFKWRKKEGEKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSTSGDSAVKKQEPTQNESKTEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEESKPSPQTSSQKSPSARPESKAPQQSDSFEDLPNTQIRKVIARRLLE...
AA_position 126
XM_017793847.1 - Gossypium arboreum - NCBI
PREDICTED: Gossypium arboreum dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC108489353), transcript variant X1, mRNA. (2483 bp)
residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial isoform X1" /protein_id="XP_017649335.1" /db_xref="GeneID:108489353" /translation="MALSMAVSRLRNPVLSRALPSLFRARFLSSFASPTPLSRSSNVERPFKDWDGSCLRSNALSTIIGVYGNSSKLKLQIGVRHFSSSDLPEHTVLGMPALSPTMSQGNIAKWKKKEGDKIEPGDILCEIETDKATLEFECLEEGFLAKILVPEGSKDVPVGQPIAVMVEDEENITKIPSTLGAGLDVEEKTAHQDVRISEKEEEPSSTNIKALGLPPHIVIGMPALSPTMNQGNIFKWRKKEGEKIEVGDIICEIETDKATLEFESLEEGYLAKILAPEGSKDVAVGQPIAITVEDPDDIEAVKTSTSGDSAVKKQEPTQNESKTEVREQKSGFTKISPSAKLLISEYGLDASSLKASGPHGTLLKGDVLAAIKSGKGSPKISPSEESKPSPQTSSQKSPSARPESKAPQQSDSFEDLPNTQIRKVIARRLL...
AA_position 127
XM_017793846.1 - Gossypium arboreum - NCBI
PREDICTED: Xenopus laevis uncharacterized LOC108718613 (LOC108718613), mRNA. (2349 bp)
alignments" /db_xref="GeneID:108718613" CDS 1..2349 /gene="LOC108718613" /codon_start=1 /product="uncharacterized protein LOC108718613" /protein_id="XP_018122428.1" /db_xref="GeneID:108718613" /translation="MDSPAATTKKCGTVTNISQATINLFCYGLEGRFVSVVIPGRAEYLTLCEVEVFGEESSSATAVNLARFGDVRQSSTYEPHYSAETAIDGIIETDISIRACTHTFDDNPAWWRLDLKKIYKIDSVVIVNRMDCCSERLLGAEIHIGDSADNNNPVCDNITDISQATITLYCNGMEGRYVSVVIPGRSEYLTLCEVEVYGEESNNSKVNLGRFGDVRQSSTYEPHYSAETAIDGIIETDIAIHPCTHTFDDNPSWWRLDLKNIYNVQTVVIVNRMDCCSERLLGAEIRVGNSGDNNNPICATITEVSQATITLSCNGLEGRYVSVVISGRAEYLTLCEVEVYGEKSKNVTVNVAQSGEVRQSSDYEPQYSAETAVDGVIESDISVHPCTHTSDDY...
AA_position 91
XM_018266939.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Lingula anatina uncharacterized LOC106167525 (LOC106167525), mRNA. (1354 bp)
start=1 /product="uncharacterized protein LOC106167525" /protein_id="XP_013401780.1" /db_xref="GeneID:106167525" /translation="MKFYVIYLCLVVALVRPTLCKDEKDYVSKDSSALPKADLHGTTLHYHYESEAKLFGPAEETFHISADVDVEYIGDGFVNYLDNNASSFLMFMRNVFVQVIKGNGTTSESEAPLSADDLYDQPTWFVQLGNGTIAEARFTKKDLGNTDVMNFKRSILSALQTNLVRDKENVIETDVMGTHNSRYSLTELQFGEIEVKKHVSSKDIYVDNNTDLDTDEVDIETDEVQRVSGGILTSVSGHVQVFQKPVEQDDTTANPEEGGNIDLGVYLTSNVTFTLTLRKHVKRSVEGVQRIEAVANAQFQKRSLVGQYDQVSGVYQRWTILRKKFDKEDKLSQAVTNFMKDPTDPSKCM" misc_feature 440..>871 /gene="LOC106167525" /note="Lipoprotein N-terminal Domain; Region: LPD_N; smart00638" /db_xref="CDD...
AA_position 171
XM_013546326.1 - Lingula anatina - NCBI
PREDICTED: Latimeria chalumnae uncharacterized LOC106707086 (LOC106707086), mRNA. (939 bp)
includes similarity to: 56% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:106707086" CDS 1..939 /gene="LOC106707086" /codon_start=1 /product="uncharacterized protein LOC106707086" /protein_id="XP_014354384.1" /db_xref="GeneID:106707086" /translation="MSGNSGHPKIETDGGAGGELSVRDEDTEQRLPKPNTVTQDCKATLYTEVMKKNVRNNMNHCPPVTPVYENVDQFQSTKNVEGLMSPENTHAGKKVSSLSDILLLGISQSQIPRLPTEQAIFQPWGCGPGQGNCSDQKVLLCNLIPAGLKPQDLRSSEEEEEEEPDYCNLDPNESGNGIPPPVPQKTHDEKQGRRPWPSPTPPEGSVRKTPCLYEEEREEEPDYCNMIETDGLLQSHDPTGHLPTITAFEKFNSTQTVYSTPHSLRTLESEMPGGDGGRHPGQLPHAFCPAKKFRNGVCMKPIPQPQEDEWTD"...
AA_position 10
XM_014498898.1 - Latimeria chalumnae (coelacanth) - NCBI
PREDICTED: Xenopus laevis adhesive plaque matrix protein-like (LOC108696886), mRNA. (2965 bp)
GeneID:108696886" /translation="MQFEGKPVSPFPGSDDDWIIETLEPTVPIPYEEQPGVVVFKDFILQMGHSGQPSRFKGKPFAPVIGKKGIWIISVQFPTGTRLFEGRPISPLTDPEGNWVVETEEATAPVPYEEKPEAPVSTDWIIQIGGPGQPSKFKGTPIAPIPNRKGEWVVEVKLPTGTVLYEGKPVAPMPSAEGAWTIETAQPSMPVQYEEKPGEPIPKGAWIMELARPGQPTKFIGRPVAPVPNKKGIWIIKVQQPTGVEEYEGKPIAQMPGTDGDWIIETDQPTVPVPYEVEPGAPSPSGDWVIEFTHDGQPTTFKGKPIGPIPGKKGYWTIQVTLPTGTMDYEGIPRSPIPGTDDWIVETGKPMVPIPYEGEPGVTIPTDWIIQLASPGQPTKFKGIPIAPIPGRKAWVVEVKLPKETMELEGKPIAPLPETDGEWLIETEQPTVPVPYETKPGEPVPKGEWIVEKAQPNKPTKFKGKPIAPILGQKDLWIIKVTQPTGIELYEGRPLSRIPGPEGEWITETAQPTMPVPYKEKPGVPTPSEDWIIEETHDDKPTKFKGRPIAPIYGKQGLWLIRVTLPTG...
AA_position 264
XM_018226578.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Daucus carota subsp. sativus dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial (LOC108210053), mRNA. (2430 bp)
dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial" /protein_id="XP_017236790.1" /db_xref="GeneID:108210053" /translation="MALSRLRHPVISRAPSLFKSRYLSAISPNLSSSSGLNRTFDVDKDFFRPTARSGYNIISETPPRMKLQIGLRHFSSSEPPSHLVIEMPALSPTMTQGNIAKWHKKEGDKIEVGDVICEIETDKATLEFECLEEGFLAKILVPEGSKDIPVGKPIAITVEDADDIQNVPSNITNDSDVKEKQPAQQTDDRVQEPSSLNIDAAKLPPHAVLEMPALSPTMNQGNIVKWLKKEGDKIEVGDVICEIETDKATLEHECLEEGFLAKILAPEGSKDIAVGQPIAITVEDSNDIEAVKTSVTGKLPVKEEKSTPHEAKTEVNKSKSGFTRISPSAKLLITEHGLDASSLLASGPRGTLLKGDVLDAIKSGKGSAGASSTVKKSPPQAQPRSSSSASESVGTRKQQSDSFEDQPNSQIRKVIAKRLLE...
AA_position 119
XM_017381301.1 - Daucus carota subsp. sativus - NCBI
Trichoderma gamsii hypothetical protein (TGAM01_03578), partial mRNA. (1227 bp)
identified_by="Prof. Giovanni Vannacci" gene 1227 /locus_tag="TGAM01_03578" /db_xref="GeneID:29983811" CDS 1..1227 /locus_tag="TGAM01_03578" /codon_start=1 /product="hypothetical protein" /protein_id="XP_018663101.1" /db_xref="GeneID:29983811" /translation="MSGLLSYIPGASLVMGSRSKTGAIDLPSVEIHHIETDADKRARCLKHLLKANHVNYAILWNDLQFDNHNPHLLSSTYLLGGNENHLNEAYNNEIKDLVPWEPSPSEVIDEDWRDFLGDKRYQRAFVDYFEDKLAMEFAYDWKKEVQHFLFSGKKPLFHALLDGLGHPIIHLGYAYEMDSKEIAMEALAMVSVKYAFLHNYLDDSSYTRPSPLKSRAPLDLLIQLSKDDRFSKDEVQVDDMQKYLKDHESAFLEYWNGWDIDDDPKKQFELSQEAAVALLVATVQPGTHAYNFFIVHLLTTSHAVRVLLPFIPPQHHVTLVRAWWLFVLAVFSIKGRPLPDYD...
AA_position 34
XM_018803728.1 - Trichoderma gamsii - NCBI
PREDICTED: Pyrus x bretschneideri exocyst complex component EXO84C-like (LOC103945139), transcript variant X1, mRNA. (2831 bp)
CDS 142..2448 /gene="LOC103945139" /codon_start=1 /product="exocyst complex component EXO84C-like" /protein_id="XP_009353938.1" /db_xref="GeneID:103945139" /translation="MESSEEEDDFPSIESITSQSKVDSLYQSHTEKGIRKLCCELLDLKDAVENLCGNMRTKYLAFLRISEEAVEMEHDLVELRKHISTQGILVQDLMTGVCHQLEEWNRSSSEVQPNPDNQELLDPLPIETDHHKIFLEKVDVLLAEHKVEEALEALDAEERNSPELKSSGDTSTTEGSSYRSVFLKRKALLEDQLVEITGQPFINFVELKKALSGLIKLGKGPLAHQLLLKFYGSRLEKSIEALLPSSSVCPRTYPATLSKLVFSTISLATTKSGLIFGDNPVYTNRVVQWAEWEIEYFVRLVKENASSDTVSALRGASICVQASLNYSLMLERQGLKLSKLILVLLRPFIEEVLELNFRRARKGVLDLIETDECMSLSPRFAPLLSAFTTSSHSLLADSGIRFMCIVEDILEQLTPLTVFHFGGNILSRIG...
AA_position 126
XM_009355663.2 - Pyrus x bretschneideri (Chinese white pear) - NCBI
PREDICTED: Myzus persicae uncharacterized LOC111033379 (LOC111033379), transcript variant X1, mRNA. (3037 bp)
alignments, including 37 samples with support for all annotated introns" /db_xref="GeneID:111033379" CDS 186..1280 /gene="LOC111033379" /codon_start=1 /product="uncharacterized protein LOC111033379 isoform X1" /protein_id="XP_022169768.1" /db_xref="GeneID:111033379" /translation="MMEIDEDLSAIEIETDPILPEVSSESFGDISCITNDDNEKENIEDPHSIETDESDQEDVTMSGSESGIVEDFTFDPTAFIEISDILDLVGKNWSIFRVSPLWNLNFDANYLNLLSKKLKKFLINRLSNNMKNRKNSFSDISVEIEAKEANQECIALKIYVTNNDTNSTLYTGLLLKSPNYNQNYDKNSLSDMPILMVQGNKSFSIAIHNWLTEHFDCVIRPYEFALYQFLWLIAISMCDAGQLYNETVLYHYLYKCESSKGQMDVKCYAESEFLRSVLAKLSMNRSSSEATSFHYSDLIKVQSDIEDHFKITSGINVSK...
AA_position 13
XM_022314076.1 - Myzus persicae (green peach aphid) - NCBI
PREDICTED: Plutella xylostella uncharacterized LOC105392207 (LOC105392207), mRNA. (1202 bp)
LOC105392207" /codon_start=1 /product="uncharacterized protein LOC105392207" /protein_id="XP_011562103.1" /db_xref="GeneID:105392207" /translation="MQNILKLCGILILVFAEISNEMKSETPIRNSSAEIMTKPHSDLLLKLQKFLETHKDTENHLNEIRSKPTPLEHVEGTTEISTFNSKLKQMNKENIAPKAPQIEKQYKVKEVIDKVNYTENKTNTIPKQLNTNNIASIIKNDTAMPIETDNNTHVFTMHFGKIPPSSTTPGTIRRSTNQKNYLRTQNEKNITTNENIMHDNGNTSLAINIETDDRESSDSDSDSDEEQAETTTVATQQPQEDKHVEVKKNTYYITKTTTRLTFVNPIKEVMNKYLRVFKRRQQLIRRRKRLSEEELLFH" ORIGIN //...
AA_position 146
XM_011563801.1 - Plutella xylostella (diamondback moth) - NCBI
PREDICTED: Nicrophorus vespilloides embryonic polarity protein dorsal-like (LOC108565974), transcript variant X1, mRNA. (2537 bp)
samples with support for all annotated introns" /db_xref="GeneID:108565974" CDS 149..2485 /gene="LOC108565974" /codon_start=1 /product="embryonic polarity protein dorsal-like isoform X1" /protein_id="XP_017781151.1" /db_xref="GeneID:108565974" /translation="MDEHSLGPARQLQQRPIEESINISDVIEVIETDPDFKQATCLPPQTTSSSVTRSNGSAGTGTMFNNSPIDPAQIRRQATVRIIEQPASKALRFRYECEGRSAGSIPGVNSTAENKTFPTIQIDGYKGKAVVVVSCVTKDHPHRPHPHNLVGRDGCKRGVCTMEISPDSMSISFSNLGIQCVKKKDIEAHLRVREEIRVDPFKTGYTHRSQPTSIDLNSVRLCFQVFTEGDKPGKFTVPLQPVVSDPIYDKKSMTDLTIVKLSDCVSSVDGGRKDIIVLCEKVSKEDIQIRFYEEKDGLVVWEGLGDFQPSQVHKQTAIWFKTPRYRTLDITEPVKVNIQLRR...
AA_position 30
XM_017925662.1 - Nicrophorus vespilloides - NCBI
PREDICTED: Diaphorina citri dentin sialophosphoprotein-like (LOC103504837), mRNA. (2712 bp)
translation="MNHSCEPNCTAEKWTVSGDTRVGLFALRDVPAGTELVFNYELQKADNDGMRRCMCGAASCSGFIGAKKAVPPTSECEKGKEVTRARKALKARRRNRRGASSGGEKGEVPAVVEVCERCGEEGGEMLRCALSRCRLSYHVACASIPVLTSASTNPGLPSGTPVQTPTHTAPSENTGLPEGTKATLSSLSDLPGGTIGLPETIGLPNKSSGLPTESADASESSTTTLPTDSNPTRSTEIPTKANTNSTPKNDSSNKVDPSSKPKIDSNLRKVVYILTPSNTSKIETDKTKVNTNNTPKNDSSNSTPKNDSKNDNTHKPDSPGKLSPEKLEEYFEKHNIVDCNVSLDDVIANQTTIVVSPTDKLKNVTTIVVSPDGKVVVEKKKPGEMETTEGKVKKEGEDGQTVEKIDERLERMDEDVKVLQKESTKVDKESTRPVKDERQSAKLVKDSTKPVKESPTKSVEDDLPTTNKKKKSSISKELRKLMIDMVQPANLDVLSSALSGGVHSDQQRPKRKSLKATKDLVDSKAVEANKDVEDTKSSKHIKDIETDTNTINTKDSDLGNVVESGRKVVVSKLRNIESGAEKEVKDA...
AA_position 282
XM_017449857.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
PREDICTED: Hyalella azteca mucin-5AC-like (LOC108666211), transcript variant X2, mRNA. (14983 bp)
xref="GeneID:108666211" /translation="MLMCYLKVCPFSKPIGLDCKIEKSPDQCCPVITCPQVPVNLQVMHMTTSTTSAPAVMQMTGIVPYVEHGCTVEEDYFPDGAQMPGNVSKPCELCYCIRNHTACIMQECILKVEGCVPVFQEGICCPVRYQCEGDKPVFPRIGGPEISDPYATVVYQPILKTTAGTTIVDEATTAVPFAGTTSQRASENVSQTDDPELQFVTGSGARRTHEEEDTFLTTTQASPQVNATTGLPFSTVIPGSISGACIHQGEIYADGALIETDDPCEHCYCMKGDLVCAIHECKSSLDEADEGCLPRPPLPGQCCPQGYTCPDQLETTSLQPDAAAGTATVTPATEVEDVDPKEEEHTTPSAVVSPVSDLSETYKPITHDDGIIETRITAGKPLLTEPADGTKPVHTVTLDIGDSELESTQSPLTTPAATEIDDDLLINSTVDAGKESVTKTPEYFEPTSAFINSTVTVNDSRVSTTPETSLTESVTDSPISQPDDKFVTSEQPSTEFPATEKPKPSSTETATDSGIPLDTSETTTLPEEHETTTTAVVVTSVITSDSRNETKTTEKPTEESHT...
AA_position 258
XM_018153040.1 - Hyalella azteca - NCBI
PREDICTED: Prunus mume dr1-associated corepressor (LOC103322124), mRNA. (1320 bp)
GeneID:103322124" /translation="MAEEQNAAREADNIAGEENAEQEEENAEQEEEKAEQAEENAEQAEEKAEQAEDDAEQEEDNAEQEEDNPENAVENATVKEKAKVAQEEENAEPIRSENSQIRPEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEVATEKKRKIVKLEHMRVAVKRHRPTSDFLWDELPVPCQPSDHQPTDRSSSRTVSHAPAPARRDRSRSRAVSDKPAPAGTRRIDHFFLTKEIPIQTEQSLIETEEAPIETEEAPIETDESPIETDEASIETEEASIEIDEAPIVTDEGPIETGEGPIETNES" misc_feature 475..666 /gene="LOC103322124" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 262
XM_008224006.2 - Prunus mume (Japanese apricot) - NCBI
PREDICTED: Centruroides sculpturatus cyclin-Y-like (LOC111639509), mRNA. (2938 bp)
and 89% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111639509" CDS 278..1384 /gene="LOC111639509" /codon_start=1 /product="cyclin-Y-like" /protein_id="XP_023241169.1" /db_xref="GeneID:111639509" /translation="MGNKLSCCTCGSPRVDRRAEDSYLPEAEVHQDESISNLQHISEREPEDIETDPSTHPTAGPLFMQRSKSDVRNCKDKRRSQINEFTTYSMGNKLSCCTCGSPRVDRRAEDSYLPEAEVHQDESISNLQHISEREPEDIETDPSTHPTAGPLFMQRSKSDVRSTSPSKVSINCLDLNTQPHKDGVPDDYDQRDPDHRTIYRFVRTLFNAAQLTAECAIITLVYLERLLTYAEVDIVPSTWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLEMLQFNINVPASVYAKYYFDLRTLADQNDLTFPSQPLSKDRAQKLEAMSRVCGDKLAELHRNGLKKWSSL...
AA_position 49
XM_023385401.1 - Centruroides sculpturatus (bark scorpion) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/IETD
lang : en | div : | spe : | query_string : IETD | format : html | download :

0.000 | 0.000 | search_start;
0.416 | 0.416 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:IETD)%7C(nt:IETD)%7C(aa:IETD))?to=0&format=json
0.728 | 0.312 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:IETD)%7C(nt:IETD)%7C(aa:IETD))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.733 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]