GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 08:12:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_198685                693 bp    mRNA    linear   ROD 24-NOV-2023
DEFINITION  Rattus norvegicus cystatin S (Cyss), mRNA.
ACCESSION   NM_198685 XM_215879
VERSION     NM_198685.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 693)
  AUTHORS   Kajikawa S, Kigami D, Nakayama H and Doi K.
  TITLE     Changes in submaxillary gland gene expression in F344 rats by
            multiple dosing of theophylline
  JOURNAL   Exp Anim 55 (2), 143-146 (2006)
   PUBMED   16651698
REFERENCE   2  (bases 1 to 693)
  AUTHORS   Iseki S, Kim JG, Kudo Y, Naito Y and Hipkaeo W.
  TITLE     Impaired induction of cystatin S gene expression by isoproterenol
            in the submandibular gland of hypophysectomized rats
  JOURNAL   Arch Oral Biol 50 (7), 653-660 (2005)
   PUBMED   15892951
REFERENCE   3  (bases 1 to 693)
  AUTHORS   Shaw PA and Yu WH.
  TITLE     Sympathetic and parasympathetic regulation of cystatin S gene
            expression
  JOURNAL   Life Sci 70 (3), 301-313 (2001)
   PUBMED   12005263
REFERENCE   4  (bases 1 to 693)
  AUTHORS   Nishiura T and Abe K.
  TITLE     Postnatal changes of gene expression for tissue inhibitors of
            metalloproteinase-1 and -2 and cystatins S and C, in rat
            submandibular gland demonstrated by quantitative reverse
            transcription-polymerase chain reaction
  JOURNAL   Arch Oral Biol 44 (1), 15-26 (1999)
   PUBMED   10075146
REFERENCE   5  (bases 1 to 693)
  AUTHORS   Abe K, Okina A, Yano T, Gao C, Ohmori H, Ishibashi K, Nishiura T
            and Letic-Gavrilovic A.
  TITLE     Abnormally high levels of cystatin S in submandibular glands,
            saliva, and gingiva of plaque-resistant rats
  JOURNAL   J Dent Res 77 (11), 1913-1919 (1998)
   PUBMED   9823730
REFERENCE   6  (bases 1 to 693)
  AUTHORS   Takahashi M, Honda Y, Ogawa K and Barka T.
  TITLE     Immunofluorescence localization of cystatins in human lacrimal
            gland and in the exorbital lacrimal gland of the rat
  JOURNAL   Acta Ophthalmol (Copenh) 70 (5), 625-631 (1992)
   PUBMED   1471486
REFERENCE   7  (bases 1 to 693)
  AUTHORS   Cox JL and Shaw PA.
  TITLE     Structure, organization and regulation of a rat cysteine proteinase
            inhibitor-encoding gene
  JOURNAL   Gene 110 (2), 175-180 (1992)
   PUBMED   1537554
REFERENCE   8  (bases 1 to 693)
  AUTHORS   Bedi GS.
  TITLE     The effects of autonomic drugs on the concentration of
            kallikrein-like proteases and cysteine-proteinase inhibitor
            (cystatin) in rat whole saliva
  JOURNAL   J Dent Res 70 (5), 924-930 (1991)
   PUBMED   2022776
REFERENCE   9  (bases 1 to 693)
  AUTHORS   Bedi GS.
  TITLE     The effect of adrenergic agonists and antagonists on
            cysteine-proteinase inhibitor (cystatin) in rat saliva
  JOURNAL   Arch Oral Biol 36 (8), 611-618 (1991)
   PUBMED   1685882
REFERENCE   10 (bases 1 to 693)
  AUTHORS   Shaw PA, Barka T, Woodin A, Schacter BS and Cox JL.
  TITLE     Expression and induction by beta-adrenergic agonists of the
            cystatin S gene in submandibular glands of developing rats
  JOURNAL   Biochem J 265 (1), 115-120 (1990)
   PUBMED   1967932
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000119.1.
            
            On Oct 27, 2022 this sequence version replaced NM_198685.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: J04206.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN12840122,
                                           SAMN12840129 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-272               JACYVU010000119.1  11091498-11091769   c
            273-386             JACYVU010000119.1  11088472-11088585   c
            387-693             JACYVU010000119.1  11087164-11087470   c
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /map="3q41"
     gene            1..693
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="cystatin S"
                     /db_xref="GeneID:296234"
                     /db_xref="RGD:735160"
     exon            1..272
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    24..26
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="upstream in-frame stop codon"
     CDS             45..470
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="LM protein; cystatin-1; protein LM"
                     /codon_start=1
                     /product="cystatin-S precursor"
                     /protein_id="NP_941958.1"
                     /db_xref="GeneID:296234"
                     /db_xref="RGD:735160"
                     /translation="
MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI"
     sig_peptide     45..125
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="/evidence=ECO:0000269|PubMed:2757396; propagated
                     from UniProtKB/Swiss-Prot (P19313.2)"
     mat_peptide     126..467
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /product="Cystatin-S. /id=PRO_0000006651"
                     /note="propagated from UniProtKB/Swiss-Prot (P19313.2)"
     misc_feature    135..461
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="Cystatin-like domain; Region: CY; smart00043"
                     /db_xref="CDD:214484"
     misc_feature    order(138..140,270..278,282..284)
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="putative proteinase inhibition site [active]"
                     /db_xref="CDD:238002"
     misc_feature    138..140
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="Reactive site; propagated from UniProtKB/Swiss-Prot
                     (P19313.2); other site"
     misc_feature    270..284
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /note="propagated from UniProtKB/Swiss-Prot (P19313.2);
                     Region: Secondary area of contact"
     exon            273..386
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /inference="alignment:Splign:2.1.0"
     exon            387..693
                     /gene="Cyss"
                     /gene_synonym="Cst4"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gttcctctccttgtcttggatcctagtccatttctaagaagatcatggcctacctgctccatgctcaactatttctactgactacctttatattagttttgaacatgagactttgtcctgttctaggtcactttctgggtggcatagagaagtctagcatggaggaggaaggagcctcagaagcattgaactatgctgtcaatgaatataatgaaaagaacagtgacttgtacctgagccgtgtggtggaagtgaaggatgtccaaaagcaggtggtggctggaaccaaatttttctttgatgtgattctaggcaaaacaatatgtttgaagacacagggtgacttgaccaactgtcccttaaatgaagaggctgatcagcaggagcatgaattctgctctttcgtggttcatgatatcccatgggagaattatattgtcttgctgagctccagctgtcatagtatatgaattagtgtcaagtgttactgtgtaggatgcagatgtctctggcaatgcctcatcactccagtggatgatctttccttgatggatgcttaccagcatggatattagcaatggaatagactgctgtgcacttagagttagacccaagcacctctccctttattcttcctctacaaatgcccatatttgcttgctcattccttgctcaataaaatgtccaacagct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]