2024-05-19 05:24:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_133621 1070 bp mRNA linear ROD 06-OCT-2023 DEFINITION Rattus norvegicus HOP homeobox (Hopx), mRNA. ACCESSION NM_133621 VERSION NM_133621.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1070) AUTHORS Kashyap S, Rabbani M, de Lima I, Kondrachuk O, Patel R, Shafiei MS, Mukker A, Rajakumar A and Gupta MK. TITLE HOPX Plays a Critical Role in Antiretroviral Drugs Induced Epigenetic Modification and Cardiac Hypertrophy JOURNAL Cells 10 (12), 3458 (2021) PUBMED 34943964 REMARK GeneRIF: HOPX Plays a Critical Role in Antiretroviral Drugs Induced Epigenetic Modification and Cardiac Hypertrophy. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1070) AUTHORS Trivedi CM, Zhu W, Wang Q, Jia C, Kee HJ, Li L, Hannenhalli S and Epstein JA. TITLE Hopx and Hdac2 interact to modulate Gata4 acetylation and embryonic cardiac myocyte proliferation JOURNAL Dev Cell 19 (3), 450-459 (2010) PUBMED 20833366 REFERENCE 3 (bases 1 to 1070) AUTHORS Asanoma K, Kato H, Yamaguchi S, Shin CH, Liu ZP, Kato K, Inoue T, Miyanari Y, Yoshikawa K, Sonoda K, Fukushima K and Wake N. TITLE HOP/NECC1, a novel regulator of mouse trophoblast differentiation JOURNAL J Biol Chem 282 (33), 24065-24074 (2007) PUBMED 17576768 REFERENCE 4 (bases 1 to 1070) AUTHORS Cheng A, Shin-ya K, Wan R, Tang SC, Miura T, Tang H, Khatri R, Gleichman M, Ouyang X, Liu D, Park HR, Chiang JY and Mattson MP. TITLE Telomere protection mechanisms change during neurogenesis and neuronal maturation: newly generated neurons are hypersensitive to telomere and DNA damage JOURNAL J Neurosci 27 (14), 3722-3733 (2007) PUBMED 17409236 REFERENCE 5 (bases 1 to 1070) AUTHORS Kee HJ, Kim JR, Nam KI, Park HY, Shin S, Kim JC, Shimono Y, Takahashi M, Jeong MH, Kim N, Kim KK and Kook H. TITLE Enhancer of polycomb1, a novel homeodomain only protein-binding partner, induces skeletal muscle differentiation JOURNAL J Biol Chem 282 (10), 7700-7709 (2007) PUBMED 17192267 REFERENCE 6 (bases 1 to 1070) AUTHORS Torrado M, Lopez E, Centeno A, Medrano C, Castro-Beiras A and Mikhailov AT. TITLE Myocardin mRNA is augmented in the failing myocardium: expression profiling in the porcine model and human dilated cardiomyopathy JOURNAL J Mol Med (Berl) 81 (9), 566-577 (2003) PUBMED 12920479 REFERENCE 7 (bases 1 to 1070) AUTHORS Adu J, Leong FT, Smith NR, Leek JP, Markham AF, Robinson PA and Mighell AJ. TITLE Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain protein, during mouse development JOURNAL Gene Expr Patterns 2 (1-2), 39-43 (2002) PUBMED 12617835 REFERENCE 8 (bases 1 to 1070) AUTHORS Shin CH, Liu ZP, Passier R, Zhang CL, Wang DZ, Harris TM, Yamagishi H, Richardson JA, Childs G and Olson EN. TITLE Modulation of cardiac growth and development by HOP, an unusual homeodomain protein JOURNAL Cell 110 (6), 725-735 (2002) PUBMED 12297046 REFERENCE 9 (bases 1 to 1070) AUTHORS Chen F, Kook H, Milewski R, Gitler AD, Lu MM, Li J, Nazarian R, Schnepp R, Jen K, Biben C, Runke G, Mackay JP, Novotny J, Schwartz RJ, Harvey RP, Mullins MC and Epstein JA. TITLE Hop is an unusual homeobox gene that modulates cardiac development JOURNAL Cell 110 (6), 713-723 (2002) PUBMED 12297045 REFERENCE 10 (bases 1 to 1070) AUTHORS Weaver AJ, Sullivan WP, Felts SJ, Owen BA and Toft DO. TITLE Crystal structure and activity of human p23, a heat shock protein 90 co-chaperone JOURNAL J Biol Chem 275 (30), 23045-23052 (2000) PUBMED 10811660 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000252.1. On Nov 25, 2020 this sequence version replaced NM_133621.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: FQ221225.1, FQ229504.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-118 JACYVU010000252.1 11063157-11063274 119-275 JACYVU010000252.1 11063400-11063556 276-1070 JACYVU010000252.1 11070139-11070933 FEATURES Location/Qualifiers source 1..1070 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="14" /map="14p11" gene 1..1070 /gene="Hopx" /gene_synonym="GIIg15b; Hod; Obl" /note="HOP homeobox" /db_xref="GeneID:171160" /db_xref="RGD:621841" exon 1..118 /gene="Hopx" /gene_synonym="GIIg15b; Hod; Obl" /inference="alignment:Splign:2.1.0" misc_feature 57..59 /gene="Hopx" /gene_synonym="GIIg15b; Hod; Obl" /note="upstream in-frame stop codon" exon 119..275 /gene="Hopx" /gene_synonym="GIIg15b; Hod; Obl" /inference="alignment:Splign:2.1.0" CDS 132..353 /gene="Hopx" /gene_synonym="GIIg15b; Hod; Obl" /note="odd homeobox 1; odd homeobox protein 1; global ischemia-induced protein 15B; global ischemia-induced gene 15B protein; global ischemia induced protein GIIG15B; homeobox only domain" /codon_start=1 /product="homeodomain-only protein" /protein_id="NP_598305.2" /db_xref="GeneID:171160" /db_xref="RGD:621841" /translation="
MSAQTASGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD"
misc_feature 159..317 /gene="Hopx" /gene_synonym="GIIg15b; Hod; Obl" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" exon 276..1070 /gene="Hopx" /gene_synonym="GIIg15b; Hod; Obl" /inference="alignment:Splign:2.1.0" ORIGIN
agccctgcgtgtgtcctcagtccttagggcagctccggacctccggaggcagctcttgaggagcttcctccactgtcccctcagagaggcaggcgagaggctctccatccttagccagacgctcacggaccatgtcggcgcagactgcgagcggccccacggaggaccaggtggagatcctggagtacaacttcaacaaggtcaacaagcaccccgaccccaccacgctgtgcctcatcgcagccgaggcgggcctcacggaggagcagacgcagaaatggtttaagcagcgcctggcggagtggcggcggtcagaaggcctgccttcggaatgcagatcggtcacggactagggagccaggcccttgagcttgctcccggaacttccgtgcctcagtttacccaggctgttttgatgtttcagtgcagtgttgaatgtctcattgtttgctgtcctgctgtttaacacaatgtgttttttgaatgtatataactaaagaaacaaaataacaggaagctaaatgcagttctgtgtaaagcgatggcttggccgggagaggggtgtggcttacgtttctctttggattttaatgaaagatgatgtgggagcagtttttgtttgcccttgaccgccactttccaatccgtatgtaccaccatccgtttcagagcattccagagctgcctggcttctgttgagaagttaaaggaacgggcaggcaggggagacacctcagtccaccttcctgtgcctctttcctccgcttcacttaacactctggtggttggatgagaacacgggtgtatttgagtcattcaatttttatatatttgaaatatagatatataaaacagttccttctcttacagctgcgttaccttggaaaacaccctcgtttagcagcgacagattccaaggggcagaaaagcaggtagctagggaaaaaaagttacagagtctagaatctaccttatttaaatgaacttgttacatttattttgctgaataacatgaaccgcttttttttgtctcaaaaattatattctaaataaaaaactttgagaatcca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]