2024-05-19 05:01:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001398571 735 bp mRNA linear ROD 12-JUN-2023 DEFINITION Rattus norvegicus claudin 25 (Cldn25), mRNA. ACCESSION NM_001398571 XM_002729920 VERSION NM_001398571.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 735) AUTHORS Berndt P, Winkler L, Cording J, Breitkreuz-Korff O, Rex A, Dithmer S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE and Haseloff RF. TITLE Tight junction proteins at the blood-brain barrier: far more than claudin-5 JOURNAL Cell Mol Life Sci 76 (10), 1987-2002 (2019) PUBMED 30734065 COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from JACYVU010000198.1. On Dec 20, 2021 this sequence version replaced XM_002729920.5. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-735 JACYVU010000198.1 11205241-11205975 c FEATURES Location/Qualifiers source 1..735 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="8" /map="8q23" gene 1..735 /gene="Cldn25" /note="claudin 25" /db_xref="GeneID:100360390" /db_xref="RGD:2322263" exon 1..735 /gene="Cldn25" /inference="alignment:Splign:2.1.0" CDS 1..690 /gene="Cldn25" /codon_start=1 /product="putative claudin-25" /protein_id="NP_001385500.1" /db_xref="GeneID:100360390" /db_xref="RGD:2322263" /translation="
MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLNLDLNEMETWVSGLWEACVNQEEAGTVCKSFESFLSLPQELQVARILMVASHGLGLLGLLLSGCGLECFRFHRPRGIFKTRLCLLGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLALGGLLLIFSACLENEEGSSPWTAEATAPPACTPVEEFDGSFHLTPRPVNQVV"
ORIGIN
atggcctgtagcttccgtgggagagtccagcttggaggtctgctcctctctgtccttggctgggtatgctcctgtgtcaccaccgttcttccccagtggaagactctcaatctggatctgaatgaaatggaaacctgggtctcgggactctgggaggcttgtgtgaatcaggaggaagctggcactgtatgtaaatccttcgagtcctttttgtctctgccccaagagctacaggtagctcgaattctcatggtggcttcccatgggctgggactgttgggacttctgctgtcgggctgtgggttggaatgcttccggtttcacaggcccagaggaattttcaagactcggctgtgcctcctgggagggactttggaagcatcagcttcagccaccaccctctttccagtctcctgggtggcctatgccacattccaagacttctgggatgacagcatccctgaaattgtgccccgatgggagtttggagacgccttgttcctgggctgggctgctgggcttttcctagctctgggtggacttctcctcatcttctctgcttgcctggaaaatgaagagggatcatctccttggacggctgaagccacagccccaccagcctgtactccagtagaggaatttgatggttccttccacctcacaccaagaccagtgaaccaggtcgtctagagctaggatctgcctagaaatctctataataaaggaatgtcagta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]