2024-05-19 08:13:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001308636 1870 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus homeo box C10 (Hoxc10), mRNA. ACCESSION NM_001308636 XM_003750414 XM_003754360 VERSION NM_001308636.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1870) AUTHORS Kato H, Ario T, Kishida T, Tadano M, Osawa S, Maeda Y, Takakura H and Izawa T. TITLE Homeobox A5 and C10 genes modulate adaptation of brown adipose tissue during exercise training in juvenile rats JOURNAL Exp Physiol 106 (2), 463-474 (2021) PUBMED 33369800 REMARK GeneRIF: Homeobox A5 and C10 genes modulate adaptation of brown adipose tissue during exercise training in juvenile rats. REFERENCE 2 (bases 1 to 1870) AUTHORS Ng Y, Tan SX, Chia SY, Tan HY, Gun SY, Sun L, Hong W and Han W. TITLE HOXC10 suppresses browning of white adipose tissues JOURNAL Exp Mol Med 49 (2), e292 (2017) PUBMED 28186086 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1870) AUTHORS Seki T, Shimokawa N, Iizuka H, Takagishi K and Koibuchi N. TITLE Abnormalities of vertebral formation and Hox expression in congenital kyphoscoliotic rats JOURNAL Mol Cell Biochem 312 (1-2), 193-199 (2008) PUBMED 18327665 REFERENCE 4 (bases 1 to 1870) AUTHORS Wu Y, Wang G, Scott SA and Capecchi MR. TITLE Hoxc10 and Hoxd10 regulate mouse columnar, divisional and motor pool identity of lumbar motoneurons JOURNAL Development 135 (1), 171-182 (2008) PUBMED 18065432 REFERENCE 5 (bases 1 to 1870) AUTHORS Wellik DM and Capecchi MR. TITLE Hox10 and Hox11 genes are required to globally pattern the mammalian skeleton JOURNAL Science 301 (5631), 363-367 (2003) PUBMED 12869760 REFERENCE 6 (bases 1 to 1870) AUTHORS Sandrock B and Egly JM. TITLE A yeast four-hybrid system identifies Cdk-activating kinase as a regulator of the XPD helicase, a subunit of transcription factor IIH JOURNAL J Biol Chem 276 (38), 35328-35333 (2001) PUBMED 11445587 REFERENCE 7 (bases 1 to 1870) AUTHORS de Stanchina E, Gabellini D, Norio P, Giacca M, Peverali FA, Riva S, Falaschi A and Biamonti G. TITLE Selection of homeotic proteins for binding to a human DNA replication origin JOURNAL J Mol Biol 299 (3), 667-680 (2000) PUBMED 10835276 REFERENCE 8 (bases 1 to 1870) AUTHORS Iimura T, Oida S, Takeda K, Maruoka Y and Sasaki S. TITLE Changes in homeobox-containing gene expression during ectopic bone formation induced by bone morphogenetic protein JOURNAL Biochem Biophys Res Commun 201 (2), 980-987 (1994) PUBMED 7911662 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000187.1. On Feb 10, 2021 this sequence version replaced NM_001308636.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: CK471575.1, BU758946.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760384, SAMEA5760386 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-751 JACYVU010000187.1 20838240-20838990 752-1870 JACYVU010000187.1 20842347-20843465 FEATURES Location/Qualifiers source 1..1870 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1870 /gene="Hoxc10" /note="homeo box C10" /db_xref="GeneID:315338" /db_xref="RGD:1307250" CDS 1..1029 /gene="Hoxc10" /note="Hox3.5 homeobox" /codon_start=1 /product="homeobox protein Hox-C10" /protein_id="NP_001295565.1" /db_xref="GeneID:315338" /db_xref="RGD:1307250" /translation="
MTCPRNVTPNSYAEPLAAPGGGERYNRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGGSPNLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCAGANEFEAPFEQRASLNPRTEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLVGPKASPSESEKERAKTADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT"
misc_feature 661..>993 /gene="Hoxc10" /note="Homeodomain-containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature order(805..819,823..825,874..876,892..894,931..933, 937..942,949..954,958..966,970..975) /gene="Hoxc10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 811..972 /gene="Hoxc10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(811..813,820..822,940..942,949..954,961..963) /gene="Hoxc10" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..751 /gene="Hoxc10" /inference="alignment:Splign:2.1.0" exon 752..1870 /gene="Hoxc10" /inference="alignment:Splign:2.1.0" ORIGIN
atgacatgccctcgcaatgtaactccgaactcgtacgcggagcccttggctgcgccgggaggaggagagcgctataaccgtagcgcaggaatgtatatgcaatctgggagtgacttcaactgcggggtgatgaggggctgcgggcttgcgccctctctctccaagagggacgagggaggcagcccaaacctggccctcaacacctacccgtcctacctctcgcagctggactcctggggcgaccccaaagccgcctaccgcctggaacaacctgttggcaggcctctgtcctcctgttcctacccacctagtgtcaaggaggagaatgtctgctgcatgtacagtgcagagaagcgggcgaaaagtggccctgaggcagctctctactcccaccccctgccggagtcttgccttggggagcacgaggtacctgtacccagctactaccgcgccagcccgagctactccgcgctggacaaaacgccccactgtgctggggccaacgagtttgaagccccttttgagcagcgggccagtctcaacccgcgcaccgaacatctggaatcgcctcagcttgggggcaaagtgagttttcctgagacccccaagtccgacagccagacccccagtcccaacgagatcaagacggagcaaagcctggtgggcccaaaagccagcccctcggagagcgaaaaggaacgggccaagaccgcagactccagcccagacacctcggataatgaagctaaagaggagataaaggcagaaaacaccacaggaaattggctgacagcaaagagcggaaggaagaagaggtgcccctatactaaacaccagacgctggaattggagaaagaatttctgttcaatatgtatttgacgcgagagcgccgcctggagattagcaagaccattaaccttacagacagacaagtcaaaatctggtttcaaaatcgcagaatgaaactcaagaaaatgaaccgagagaatcggatccgggaactgacctccaattttaatttcacctgagccagcgtcatctcctcccccctccccttctctcctttccccgcccctcctccctttgtgcctggtgatatattttttcccctccctgagtataaatgcaatgcgcctgcaaaaaaaaaaaaaaaaaaaaaaaaaggcaaagacctcagactctccttccaagggacctatggttcgtgcttcgaggatgcttccacctaaagcatgaaaatggggtgctgggttttggggtgttgtgtgtgccctcatagacagggtggtagtgtggccggtgtgtgtgtcaactcctcagtcacccatgcacacacatgcagccttctgttctccatgcaaagttgaggtcaaatccacccaattataggggaaagaaagggggataaaatcagagagggtctgtaacctcgtagagcacagttagaattgctccctccttgctgcattccccctcttagaataatagatagtcttgaaagttcggctagtatttgtgtgtttgtcatagcacccagtgtctagactaaccctccctgtgtgtttccctcccaatggctctgagaatatgcttgaagtatttgtactgctttctgcttttctcccacccttcccaacacactgtatctctctctcttcctaacatctcagaaattccacacagaagaacaaaaacattaaaaaatagaacatagcaaagtaaaaacaaattccacccccaccccaagttgtcctgctcctgtctgggagttgtgttatttaaagataatctgtatgttgtatcttttgcatgtagcttccttaatggagaaaaaattcctaataaatttccggaatcttgatcctcaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]