2024-05-19 04:49:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001106796 843 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus homeo box C12 (Hoxc12), mRNA. ACCESSION NM_001106796 XM_001068476 XM_235696 VERSION NM_001106796.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 843) AUTHORS Gaudet P, Livstone MS, Lewis SE and Thomas PD. TITLE Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium JOURNAL Brief Bioinform 12 (5), 449-462 (2011) PUBMED 21873635 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH474035.2. On or before Oct 4, 2007 this sequence version replaced XM_001068476.1, XM_235696.1. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..843 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..843 /gene="Hoxc12" /note="homeo box C12" /db_xref="GeneID:300262" /db_xref="RGD:1310539" CDS 1..843 /gene="Hoxc12" /codon_start=1 /product="homeobox protein Hox-C12" /protein_id="NP_001100266.1" /db_xref="GeneID:300262" /db_xref="RGD:1310539" /translation="
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAEGGGGGLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYPAGGGGGDGNTGPPHDPPSCQSLESDSSSSLLNEGNKGASAGDPGSLVSPLNPGGGLSASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF"
misc_feature order(637..651,655..657,706..708,724..726,763..765, 769..774,781..786,790..798,802..807) /gene="Hoxc12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 643..804 /gene="Hoxc12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(643..645,652..654,772..774,781..786,793..795) /gene="Hoxc12" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..604 /gene="Hoxc12" /inference="alignment:Splign:2.1.0" exon 605..843 /gene="Hoxc12" /inference="alignment:Splign:2.1.0" ORIGIN
atgggcgagcataatctcctgaatcctgggtttgtggggccgctggtgaatatccacacgggagacaccttctacttccccaacttccgcgcgtcaggggcgcaactcccggggctgccttcgctgtcctacccacgccgcgataacgtgtgctcgctgccctggccgtcggccgagccgtgcaatggctacccgcagccctatctcggcagtccggtgtctctcaacccgccttttggccgcacgtgcgagttggctcgcgtggaggatagcaagggttactaccgagagccctgcgctgagggcggcggcgggggcctaaagcgggaggagcgcgggcgcgaacccggagcgggacccggggcagcgctgctgcagctggagccgtcggggccacctgcgctcggcttcaagtacgactacccagcgggcggcggcggtggcgacggcaacacgggacccccccacgacccaccctcgtgtcagtcattggaatctgactccagttcatccctactcaacgagggcaataagggcgccagtgctggcgaccctggctctctggtatctccgttgaacccaggcggcgggctctcagccagcggcgcgccctggtacccgatccacagccgctcgcgaaagaagcgcaagccgtattcgaagttgcagctggctgagctggagggcgagtttctggtcaacgagttcatcacacgccagcgtcggagggaactctcggaccgcttgaatcttagtgatcagcaggtcaagatttggttccagaaccggagaatgaaaaagaaaagacttctgctgagagagcaagctctctccttcttctag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]